(data stored in ACNUC10821 zone)

EMBL: AE017262.PE462

AE017262.PE462       Location/Qualifiers
FT   CDS_pept        483130..483705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0468"
FT                   /product="PBS lyase HEAT-like repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03252"
FT                   /protein_id="AAT03252.1"
FT                   /translation="MENILLASINNSDENTRIFAYEYLYYFDSEAVFQAALIGTTDDDD
FT                   LVQMCSIEILGNLVKVESLPYLKKALGDNNPDVRCFAAESIGFVGTDEAKAILQEQLNR
FT                   ETDSFAKVGIYYALYLLGREEMLPKLLSLLDDNYHLTVIRSLDVLRDVVNQTNKENILL
FT                   NIEKLLKRDIPISVKEKAEVVLQEIKGS"
     ttggagaaca tcttactagc tagcataaat aatagcgatg agaatactcg aatatttgcc        60
     tatgagtatt tatattattt tgatagcgaa gcagtttttc aagcagccct catagggaca       120
     acagacgacg atgatttagt tcaaatgtgc tccatagaga ttttaggaaa tttggttaaa       180
     gtagaaagtc tcccgtattt aaagaaggcg ttgggcgata acaaccctga tgtacgttgc       240
     tttgctgctg aatcaatcgg ttttgtaggg actgacgaag cgaaagcgat actgcaagaa       300
     cagttaaata gagaaacgga ttcttttgca aaagtaggta tttattatgc gctctatctt       360
     cttggtcgag aagaaatgtt gccaaagctc ctttctctac tagacgataa ttatcatttg       420
     acggtgatta gaagcttgga tgttctgaga gacgttgtta atcaaacaaa taaagaaaat       480
     atattattaa atatcgaaaa acttttaaag agagatatcc caatttcagt aaaggaaaaa       540
     gcggaagtgg ttttacaaga aattaaagga agctaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page