(data stored in ACNUC10821 zone)

EMBL: AE017262.PE463

AE017262.PE463       Location/Qualifiers
FT   CDS_pept        483744..483869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0469"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03253"
FT                   /protein_id="AAT03253.1"
FT                   /translation="MIFIAKLVKAKIFIHDIKIKLEEINSQFRNKKNYQPATHTK"
     gtgattttta tagcaaaact agtaaaagct aaaattttta ttcatgatat aaagattaaa        60
     ctcgaagaaa tcaattctca gttcagaaac aaaaagaact atcaaccagc aacgcataca       120
     aagtaa                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page