(data stored in ACNUC10821 zone)

EMBL: AE017262.PE467

AE017262.PE467       Location/Qualifiers
FT   CDS_pept        489490..490335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0474"
FT                   /product="putative ytfG protein"
FT                   /note="identified by similarity to SP:P39315"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03257"
FT                   /protein_id="AAT03257.1"
FT                   /translation="MTYLVTGATGGLGGYALNYLKELVPMSDIYALVRSEEKGADLKAA
FT                   GFNIRVGDYSDAESMKQAFVGIDRVLFVSGAPGNRQVEHENVVNAAKAAGVSYIAYTSF
FT                   AGADKSTSALAEDHFFTEKVIEKSGIAHTFLRNNWYFENEMPMIGGALSAGKFVYAAEN
FT                   GKVGWALKREYAEVAAKAVAGADFPEILELSGPLMTYEELTKALKEATGKDFDVISSDD
FT                   KGFVENLVSAGLPQPVAEMFLSFQHDIKNDQLDVTSDDFEKALGKPLTNRVDALRELLK
FT                   "
     atgacttatt tagtaacagg tgcaacaggt ggacttggag gctacgcatt aaattatttg        60
     aaagagctcg ttccaatgtc cgatatttat gctttagttc gtagcgaaga aaaaggtgca       120
     gacttgaaag cagcaggatt taacatccga gttggtgatt atagtgatgc agaatcaatg       180
     aagcaagcat tcgtaggaat cgaccgtgta ttatttgtat cgggcgctcc tggtaatcgc       240
     caagtagaac acgaaaacgt ggtaaatgcg gcaaaagcag caggtgtttc ttacattgct       300
     tacacaagtt ttgcaggcgc agataaatcc acaagcgctt tagcagaaga tcatttcttt       360
     accgaaaaag taatcgaaaa atccggaatc gcgcacactt tcttgcgtaa caactggtac       420
     ttcgaaaatg aaatgccaat gattggtggc gcattaagtg ctggaaaatt tgtatacgct       480
     gctgaaaatg gaaaagttgg ctgggcatta aaacgcgaat acgcagaagt agccgcaaaa       540
     gctgttgcgg gcgctgactt cccagaaatc cttgaattat ctggcccact catgacatac       600
     gaagaactta caaaagcatt aaaagaagca actggaaaag atttcgacgt tatttcttca       660
     gatgataaag gatttgtaga aaatttagtt tctgccggtt taccacaacc tgtcgcagaa       720
     atgttcttat ccttccaaca cgacattaag aacgaccaat tagatgttac ttctgatgat       780
     tttgaaaaag cattaggaaa accattaacg aatcgcgtag atgcgcttcg ggaattgttg       840
     aaataa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page