(data stored in ACNUC10821 zone)

EMBL: AE017262.PE469

AE017262.PE469       Location/Qualifiers
FT   CDS_pept        complement(491141..492409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0457; match
FT                   to protein family HMM PF00668"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03259"
FT                   /protein_id="AAT03259.1"
FT                   /translation="MVKITSYPAEPSDVKHYISGEKMKNDHHLHTVLTFDNHLNIDVLK
FT                   KAVMQSTKKLPLLLCHFKETKKGAFWQESVFSAEDLVFLVETQAPETEVDRALVTKLST
FT                   ENGPQICFTVVRADTSDQLVVIMNHMLADGAGFKEYLYLLSELYSNLLENPDYAANLSL
FT                   GSRSLKQIFDQFSRKDIKSIFTEKTKQKAVHNPTFPLKGDPKNPKFIWTKLPKEDFSEI
FT                   IHFAKEHEATVNDVLFAAMARTVQQTTGQQEMSIDCPVDLRKYLPSKTSSGITNLTANI
FT                   TCQISANDDLTSFESTLQAVKNSLNPQKNSFAPLRIYYLLELIFKKKNYSVAKKASEKM
FT                   YSIPKTSFTNIGIIDEEKLVFEGSTLTDCFICGSLKYAPFFQVAATTFRGELTLSTNLH
FT                   GTTQDHAWQKDFLEQMISEFPSK"
     atggtaaaaa tcacgagtta tcccgctgaa ccttctgatg ttaaacatta tatttctgga        60
     gaaaaaatga aaaatgacca ccatttgcat acggtactta cgtttgataa tcatttaaat       120
     atagacgttc taaaaaaagc agtgatgcag tctactaaaa aacttccgct attactttgt       180
     cattttaaag aaacgaaaaa aggtgctttt tggcaagaaa gtgttttttc tgcggaggat       240
     ttggttttct tagtggaaac gcaagcgcca gaaaccgaag tggaccgagc acttgtaacg       300
     aagctttcca cagaaaatgg gccgcaaatt tgctttactg ttgttcgggc tgatacttct       360
     gatcagcttg tggttattat gaatcatatg ttagcagatg gcgctggatt taaggaatat       420
     ctttatttat tgagtgagct ttattctaat ctgcttgaaa atccggatta tgcggcgaat       480
     ttgagcttag gttcccggag tttaaagcaa atttttgatc aattttcgcg taaagatata       540
     aagtccattt ttacggaaaa aacgaagcaa aaagctgtcc ataacccaac tttccctctt       600
     aaaggtgacc cgaaaaatcc gaaatttatt tggactaagc taccaaaaga ggatttttcg       660
     gaaatcatcc actttgcaaa agagcacgag gcaactgtga atgatgttct gttcgccgca       720
     atggcgcgca ctgttcagca aacaacaggg caacaagaaa tgtcaattga ttgcccggtg       780
     gatctccgta agtatttgcc gagtaaaacc agtagcggaa ttaccaatct caccgccaat       840
     attacatgcc aaatcagcgc aaacgatgac ctaacgtcat ttgaaagcac actccaagcc       900
     gtcaaaaatt cactcaatcc acaaaaaaac agctttgcac ctctacgaat ttattattta       960
     ttggaactga ttttcaagaa aaagaactac tctgttgcaa aaaaagcttc tgaaaaaatg      1020
     tattctattc cgaaaacaag ttttacgaat ataggtatta tcgatgagga aaaactcgtt      1080
     tttgaaggta gcactttaac agattgtttt atttgtggtt ctttaaagta tgcgccgttt      1140
     ttccaagtcg ctgctacaac tttccgcggc gagctgacac tgagtactaa tttgcatggt      1200
     actacgcaag atcatgcttg gcagaaagac tttttggagc agatgatttc ggaatttcct      1260
     tctaaataa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page