(data stored in ACNUC10821 zone)

EMBL: AE017262.PE470

AE017262.PE470       Location/Qualifiers
FT   CDS_pept        492547..493050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0477"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03260"
FT                   /protein_id="AAT03260.1"
FT                   /translation="MTNRTLTTKLLGTLSYTQENGTMMDAVIPLDGKEVKVDYSIFEKL
FT                   TSEDYFKDIVTLTDQIPELHLEAKKTILEQFDGNDTLTIYFDFHTDELPEAVLEVTECD
FT                   ALENITKEILIDKLVLSGVWFSENANNELDLTFDFKLLPEVSDELLVVRFNTKGEITEL
FT                   THES"
     atgacaaaca gaacattaac aaccaagtta ctaggaacac taagctatac gcaagaaaat        60
     ggaacgatga tggacgccgt aattcctttg gatggcaaag aagtaaaggt tgattatagt       120
     atttttgaaa agcttacttc agaagattat tttaaagata tcgttacttt aacggatcaa       180
     attccggaac tacacctaga agcgaaaaaa actattttag agcaatttga tggaaatgat       240
     acgcttacta tttattttga ttttcataca gatgaattgc ccgaagcggt tttagaagtt       300
     accgaatgtg atgcgctaga aaatataaca aaggaaatct taatcgataa actagttttg       360
     tcaggcgttt ggttttcgga aaatgccaat aatgagttgg atttaacatt cgatttcaaa       420
     ctattaccag aagttagcga tgaactttta gttgttcgtt ttaatacaaa aggagaaatt       480
     actgaattaa cccatgaaag ttaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page