(data stored in ACNUC10821 zone)

EMBL: AE017262.PE472

AE017262.PE472       Location/Qualifiers
FT   CDS_pept        495300..495614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0459"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03262"
FT                   /protein_id="AAT03262.1"
FT                   /translation="MEEMEQPEKKVIIRGKGIHNKWKWSTIIVSILSVIIISVLSYQLY
FT                   SVSQNTPENNTNGTMQGPGGGEMPSGTPPSGEPGQAPNSSDDSSDSGTSDSTTSSDGTL
FT                   "
     atggaagaga tggagcaacc agaaaagaag gtcattattc gtgggaaagg catccacaat        60
     aaatggaagt ggagcacgat tattgtcagt attctttctg tcataattat tagtgtttta       120
     agttatcagc tgtattcagt tagtcaaaat accccggaaa ataatactaa tggaaccatg       180
     caaggtcctg gtggaggaga gatgccgagt ggaacgccgc cgtccggtga acctggccaa       240
     gcgccaaata gttcagatga tagttctgac tctggaacaa gtgatagtac tacaagcagc       300
     gacggaaccc tttaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page