(data stored in ACNUC10821 zone)

EMBL: AE017262.PE473

AE017262.PE473       Location/Qualifiers
FT   CDS_pept        495751..496680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0480"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by similarity to SP:Q02115; match to
FT                   protein family HMM PF03816; match to protein family HMM
FT                   TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03263"
FT                   /protein_id="AAT03263.1"
FT                   /translation="MARHAQKRKARKGRIFVTILVALLILVGVVAVIGYFQYQSSLKEA
FT                   QNESKLKDYKFNGAKAVGDEINVLLIGSDSRGEDQGRSDSLMIAHYNTKTNTPKLVSIM
FT                   RDTYVDIPGHGKNKINAAYSYGGPELVRQTIKENFGVDVQYYVVANFEGFPKIVDTLAP
FT                   EGIKINAEKDMSKNIDANIKKGEQVMDGKTLLQYARFRKDAEGDFGRIRRQQQVLEALK
FT                   EQAIDVGDVAKIPDVIGKLQGYSSTNIPTGTLMSIGADFLLGKTETMEKFAIPVEGKWH
FT                   NERIDGAGAVLRLDDMAANAKALQDFLK"
     atggcaagac atgcacaaaa aagaaaagcg cgcaaaggta gaatttttgt tacgattctt        60
     gtagccctat taattttagt tggtgtagtt gcagttatag gttatttcca atatcaatct       120
     agcttaaaag aagcgcaaaa tgaaagtaaa ttaaaagact acaaattcaa tggtgccaag       180
     gcagttggcg atgaaatcaa tgtactactt atcggtagtg actctcgcgg tgaagaccaa       240
     ggccgttcag acagcttgat gattgctcat tataatacga aaacaaatac gccaaaactg       300
     gtatcgatca tgcgtgatac atacgtagat attccaggac acggcaaaaa caaaatcaat       360
     gcagcatatt catacggcgg accagaactt gtacgccaaa cgattaaaga aaattttgga       420
     gtagacgtac aatattatgt agtagccaat tttgaaggtt tccctaagat tgttgataca       480
     cttgcaccag aaggaatcaa aatcaacgca gagaaagata tgtcgaaaaa tattgacgca       540
     aacattaaaa aaggcgaaca agtaatggat ggtaaaacat tgttacaata tgctcgcttc       600
     cgtaaagatg cagaaggaga cttcggtcga attcgtcgtc aacaacaagt attagaagct       660
     ttgaaagaac aggcgattga tgttggtgac gtggcaaaaa tcccagatgt tatcggaaaa       720
     ctacaaggtt attcttccac taatatccca acaggaacat taatgtccat tggcgcagat       780
     ttcctactag gaaaaacaga aacaatggaa aaattcgcga ttcctgttga agggaaatgg       840
     cacaatgagc gaattgatgg agcgggagca gtgcttcgtt tagatgatat ggctgctaac       900
     gcaaaagctt tacaagattt tttgaaataa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page