(data stored in ACNUC10821 zone)

EMBL: AE017262.PE475

AE017262.PE475       Location/Qualifiers
FT   CDS_pept        497510..498235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0482"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0463"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03265"
FT                   /protein_id="AAT03265.1"
FT                   /translation="MKDKTKKRKWNWAQILAIFVLVTLVVSMVYATVNLITAPSGNVPE
FT                   GQQTKGDYSLMLMQCVLGVVVLFLPSIISKKMKFVIPNAMYIVFIVFLYCAIYLGEVRS
FT                   FYYLIPNWDTILHTFSGAMLGGLGFSIVSLLNNDERITLSMSPVFVALFACSFAVFLGV
FT                   FWEFYEFAADSFGMNMQKTMLEDGTMLQGHAAVADTMGDLFVDFLGAFVISIIGYFSIR
FT                   KNKKWMKNFEFKKVDEEVK"
     atgaaggaca aaacaaagaa aagaaaatgg aactgggcac agattttggc tatttttgta        60
     ttagtaacgc tcgtagtttc gatggtttat gcaacagtta acttaattac agcgccatct       120
     ggtaatgttc cagaaggaca acaaacaaag ggcgactact cacttatgct tatgcagtgt       180
     gtacttggcg tggtagttct attcttacca tccatcatta gtaaaaaaat gaaattcgtc       240
     attccgaatg cgatgtatat tgtttttatc gttttcttat attgtgccat ttatcttggc       300
     gaagttcgta gtttctatta tttaattcct aactgggata cgattctaca tacgtttagt       360
     ggggcaatgc ttgggggact tggtttttct attgtgagct tactgaataa tgatgaacgg       420
     attactcttt cgatgagtcc ggttttcgtt gcattatttg cttgtagctt tgctgttttc       480
     ttgggtgttt tctgggagtt ctatgaattt gcagccgata gctttggaat gaacatgcaa       540
     aaaacaatgc tagaagatgg cacgatgctt caaggtcatg cagcagttgc tgatacaatg       600
     ggcgatctgt tcgtcgactt cctcggggct ttcgtgatat ccatcatcgg ctacttctcc       660
     attcgcaaaa ataaaaaatg gatgaagaac ttcgaattta aaaaagtaga tgaagaagta       720
     aaataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page