(data stored in ACNUC10821 zone)

EMBL: AE017262.PE477

AE017262.PE477       Location/Qualifiers
FT   CDS_pept        complement(498965..499720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0465"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03267"
FT                   /protein_id="AAT03267.1"
FT                   /translation="MTTIFPKEQNVAPLFEQILANPTACRRFKDVFLDNLESYQETRGF
FT                   EKDDTLFAKIILSAYRQSDVSALLLGVCGRTLFELLRQAFLIPKKLTVDNPFFLTDKEG
FT                   NFIAKKDDISNREQEKFQEIYQSDLHHSETTIFLVDDDDIIHSYEPDFSISTKRINKKR
FT                   GILVLYSLPDTLKLGMTESEVYAFIWKTFLHIQEIIPSSRIFYGQETSENADELGVFLP
FT                   IHHFEKKMLQNIEQVNELVDALREQMVNK"
     atgacaacta ttttcccaaa agaacaaaat gtcgctcccc ttttcgaaca gatattggct        60
     aatccaacag cttgcagacg ttttaaagat gtatttctag ataatttaga gagctaccaa       120
     gagacgcgtg gttttgaaaa agatgatact ctttttgcta aaattatttt gtcggcttat       180
     aggcaaagtg atgtaagtgc cttgttgtta ggtgtttgcg ggagaacatt attcgaactt       240
     ctcagacaag ctttccttat tcctaaaaaa ttaacagtgg ataacccgtt ctttttaaca       300
     gataaagaag gtaattttat agccaagaag gacgatattt ctaaccgcga acaggagaaa       360
     tttcaagaga tttatcaatc ggatttgcat cattctgaaa caacgatttt cttagtagat       420
     gatgatgata tcattcattc ctacgagcca gatttttcga tttctactaa acgaattaat       480
     aaaaaaagag ggattttggt actgtattct cttcctgata ctttaaagtt aggaatgact       540
     gaatcggaag tctatgcgtt tatttggaaa actttcttgc atatacagga aatcattcca       600
     tccagccgaa ttttctatgg acaagaaaca tcagaaaatg cagatgaact tggcgtattt       660
     cttccaattc accattttga gaaaaaaatg ctgcaaaata ttgagcaagt taatgagcta       720
     gttgatgctc ttcgtgaaca aatggttaat aaataa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page