(data stored in ACNUC10821 zone)

EMBL: AE017262.PE48

AE017262.PE48        Location/Qualifiers
FT   CDS_pept        52636..53415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0050"
FT                   /product="phosphosugar-binding protein"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02838"
FT                   /protein_id="AAT02838.1"
FT                   /translation="MDFFEISSKTVASLTRNERILFDYVVKNMNLIKNQSIREVSAECF
FT                   VSTTTFLRFVRKLGFTGYSEFTTVLKFTLLGHTELKPSPFVVEQSDYREEYLKNIIESV
FT                   RVLEPSKIKKITKKLVSKPRIYFFAKGLSKHAAKYIKYLYTMSGFLVEFPEDYQYRQAV
FT                   LPHIGKDDLVFILTYGGHDIELIQTAQKLKSRNETPMLISITGADNNIIQNMSDINLYI
FT                   FTDEIEMNNLDITSRISTIAIMELILYQFMEDETSSF"
     atggactttt tcgaaatttc cagtaagact gtagcttccc taactcggaa tgagcggatt        60
     ttatttgact atgtcgttaa gaatatgaat ttaattaaaa atcaaagtat tcgagaagtt       120
     tctgcagaat gctttgtttc aacaacaact tttttgcgtt ttgtaagaaa gcttggattt       180
     actggttata gcgagtttac aacagtctta aagttcactt tacttgggca tacagagcta       240
     aaaccgtccc catttgtcgt agaacagtcg gattatcgtg aagaatattt gaaaaacatt       300
     attgaatctg tccgagtttt agaaccaagt aaaatcaaga aaatcaccaa aaaactagta       360
     agcaaaccgc gaatttattt ttttgctaaa gggctgagta aacatgctgc gaaatacatc       420
     aaatatctct atacaatgag cggatttttg gtagagtttc ctgaagatta tcagtatcgc       480
     caagctgtat tgccgcatat tggtaaagat gatttagttt ttatccttac gtacggtgga       540
     catgacattg aattaatcca aactgcccaa aaactaaaaa gcagaaatga aacgcccatg       600
     ttgatttcga ttactggggc tgataataat attattcaaa atatgagtga tattaattta       660
     tatattttta cagatgaaat tgaaatgaat aatttagata ttacttctcg catctctaca       720
     attgcaatta tggagctaat cttataccag tttatggaag atgaaactag tagtttttaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page