(data stored in ACNUC10821 zone)

EMBL: AE017262.PE480

AE017262.PE480       Location/Qualifiers
FT   CDS_pept        complement(503146..504093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0487"
FT                   /product="magnesium chelatase, subunit ChII family protein"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM PF07726"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03270"
FT                   /protein_id="AAT03270.1"
FT                   /translation="MSIEPSIKIEEIINEVEKVIVGKRHVVKLSLTALLAGGHVLLEDV
FT                   PGVGKTMMVRTLSKTIGVSFKRIQFTPDLLPADVTGVSIFNPETRDFEFRPGPVMGNIV
FT                   LADEINRTAPRTQAALLEGMAENSVTVDGITRKLANPFFVMATQNPIEYEGTYALPEAQ
FT                   LDRFLLKINIGYPTVEEEMQLLTLKQYQDPLDQTQQVVTLSELLDLKNKAKQVFIDDVL
FT                   KNYIIRLVDATRKHPSVALGISPRGSLAFMQAAQAFALIEGRDYVIPDDIQYLAPYIFT
FT                   HRLILKSEAYYNEETAESIIASILKNTSVPVEKR"
     atgtctatag agccatccat taaaatagaa gaaattatta atgaagttga aaaagtaatc        60
     gtcggtaaac gacatgttgt taaattaagc ttaactgccc tacttgcggg tggtcacgta       120
     ttattagaag atgttcccgg tgttggtaaa acgatgatgg tccgcaccct ttctaaaaca       180
     attggtgttt cctttaaacg aattcaattt acaccagatt tacttcccgc agatgtgacg       240
     ggggtttcga ttttcaatcc tgaaacacgt gattttgaat tccgtccagg tcctgtcatg       300
     ggaaatattg ttcttgcgga tgaaattaat cgtactgcgc ctcgaactca agccgcttta       360
     cttgaaggta tggctgagaa tagtgtgaca gtggatggta ttacgcgcaa acttgccaac       420
     ccatttttcg ttatggcgac gcaaaatccg attgaatacg aaggaacgta tgcccttcca       480
     gaagcacaat tagaccgatt tttactcaaa attaatattg gttacccgac agtcgaagaa       540
     gaaatgcagc tgcttacatt aaaacaatac caagatccac ttgatcaaac gcagcaagtg       600
     gtgacactca gcgaattact ggacctaaaa aacaaagcaa agcaagtctt tattgatgat       660
     gttttaaaaa attatattat tcgcctagtt gatgcgactc gaaaacaccc ttccgttgcg       720
     ctcggaatta gtccgcgtgg ctcgctcgct ttcatgcaag ccgctcaagc ttttgcgctt       780
     attgaaggtc gagattatgt gattcctgat gatattcagt atttagcacc gtatattttc       840
     actcatcgtc tcattttgaa gtctgaagct tattataatg aggaaacagc cgaatccatt       900
     attgcttcca ttttgaaaaa cacgtcagtt ccggtagaaa agaggtag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page