(data stored in ACNUC10821 zone)

EMBL: AE017262.PE481

AE017262.PE481       Location/Qualifiers
FT   CDS_pept        504261..505844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412913; match to
FT                   protein family HMM PF07905"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03271"
FT                   /protein_id="AAT03271.1"
FT                   /translation="MADLMKLPSLKEAKVVSGKSGLSKLVSSISVLEYTEVALLEDDLF
FT                   DNDEFYGSEIVVSAFVNIRDDVEAQCRTIERLHKVGEVALILYYVGIFVPKMDQKLIDF
FT                   ANELDFTIIVMPENEMSLRYSEVIYEVVEAIVKQEMTDTNFVTESLEQISSVRPPQRNI
FT                   DTTLKILSDRTHTSLVLTDNSFQVINSITWPRTRHWDFERIIEASKQIGEHELVQLTLD
FT                   ERDFYTARKPIFQDGMQAMHLFMMKEKGVLTADVVMQITEVVQVFMNLWGRNYVEISTA
FT                   ELMKAILNDESVKMRRLGKILNVDVSSIKWMWLVKTEEIRDNEQVLAELKSFVASHFQV
FT                   SLIDLFEDNIVVLLDNSVAQRDRTHTANEFAMMMKEHGIDLKITVCQGMEQTSDVQSAY
FT                   SLVNEYKNAANAIYANKSIYSLQEIDFAAKCVEIVDRGELAIAEQMRPLKPLEDNDELI
FT                   ETLSVFLLEGESNYNQAAELLFLHKNTIKYRIQRINELLQYPATKIPESYNLYLAVAIR
FT                   RILGGNNNNK"
     ttggcagatt taatgaaatt accatcttta aaagaagcga aagtagtctc tggaaaatct        60
     ggattatcta agcttgtttc gtctatttct gttttagaat atacagaggt agctctttta       120
     gaagatgatt tatttgataa tgatgaattt tatggcagtg aaatagttgt atcggctttt       180
     gtgaatattc gtgacgatgt tgaggcacag tgtcggacaa ttgagcgatt acataaggtt       240
     ggcgaagttg ctttaattct ttactacgtg ggaatttttg tgccgaaaat ggatcaaaaa       300
     ctgattgatt ttgcaaatga acttgatttt accattatcg tgatgccgga aaacgagatg       360
     tcacttagat atagcgaagt gatttatgaa gtagtcgaag cgattgtgaa gcaagaaatg       420
     acagatacca actttgtaac cgagtcatta gaacagattt cgagtgtgcg accgccacaa       480
     cgaaatatag ataccacact gaaaattttg tctgatagaa cgcatacttc gctcgtctta       540
     acggataatt ctttccaagt aattaattct atcacttggc cacgaacgcg ccactgggat       600
     tttgaacgga taattgaggc atctaaacaa atcggtgaac atgagcttgt acagcttacc       660
     ttggatgaac gcgattttta tacggccaga aaaccgattt ttcaagacgg tatgcaagcg       720
     atgcacttat ttatgatgaa agaaaaaggc gtattaacag ccgatgtagt catgcaaatt       780
     accgaagtag tccaagtatt tatgaattta tggggcagaa actatgtcga aatcagtaca       840
     gctgaactga tgaaagccat tttaaatgat gaaagtgtca aaatgcggcg acttggtaag       900
     attttaaatg tggatgtttc ttctattaaa tggatgtggc ttgtaaaaac cgaagaaatt       960
     cgcgacaatg agcaagtttt agctgaactg aaaagttttg tagctagtca cttccaagtt      1020
     tcattaattg atttatttga agacaatatc gttgttttac ttgataattc agtggcgcag      1080
     cgggaccgga cgcatacagc caatgagttt gcgatgatga tgaaagaaca tgggatagac      1140
     ttgaaaatta ccgtttgcca aggaatggag caaacgtcag atgtgcaaag cgcttattcg      1200
     ctcgttaatg aatataaaaa tgcggcaaat gcgatttatg cgaacaagtc catttattct      1260
     cttcaagaaa ttgatttcgc agcaaaatgt gtggaaatag tagatcgagg agaactagca      1320
     attgcagaac aaatgaggcc actaaagcct ttagaggata atgatgaact aattgaaacg      1380
     ctgtctgtgt ttttactgga aggtgaatcc aattataatc aagcagctga actactattc      1440
     ctgcataaaa atacgattaa atatcgaata caacggataa atgagttatt gcaatatccg      1500
     gcgacaaaaa tcccagaatc ctacaacctt tatttagcag tggcgattcg acggattctt      1560
     ggtggaaata acaataataa ataa                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page