(data stored in ACNUC10821 zone)

EMBL: AE017262.PE482

AE017262.PE482       Location/Qualifiers
FT   CDS_pept        505978..507261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0489"
FT                   /product="cytosine/purines/uracil/thiamine/allantoin
FT                   permease family protein"
FT                   /note="identified by match to protein family HMM PF02133"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03272"
FT                   /protein_id="AAT03272.1"
FT                   /translation="MTEKKSVEQTQSWQSLAFVWTGAMICVPSLLVGGTLISGMPLWEA
FT                   ILIALLGYGVIVLFMIYQGMQSSDLGIPAVSVASQVFGEQGSKKIISILLAIACLGWFG
FT                   IQANVCGAAFSQFLGIYGINLPVPVSSLIWGVIMLLSAIYGIRILSILNYIAVPVLLFV
FT                   CIYGLVVSLNDGGLAIVENYKPAGSMSFMTGLAITIGSFALGAVIAGDYSQYTKSRKDV
FT                   VKAAIVGILPSGVLMITVGAVLALTAGTADISVVFTNLGLPVLGIIGLILAAWTTNAVN
FT                   AFSGGIAIINVFNISEKYHKVAVAVAGGLGTILAVIGILNHFVPIMSVLSAMVPPVAGV
FT                   MIASYWIVQKGDKSKWAPVSGVNWLGVSSWLVGAVIAGIPVILTFFPELPQLPNQPLIG
FT                   IILSLAVYLIGAKVLSGKTNNVENLEGK"
     atgacagaga agaaatcagt ggagcaaacg caatcctggc agagtttagc atttgtatgg        60
     accggagcaa tgatttgtgt accgagtcta ctagttggag gaactttaat ttcaggtatg       120
     cctctttggg aagcaatttt aatagcactt ttaggatacg gcgttattgt cttatttatg       180
     atatatcaag gaatgcaaag tagcgattta ggtattccag cagttagtgt agcttcacag       240
     gtttttggag aacaagggtc gaaaaaaatc atatctattc ttttagcgat tgcttgtcta       300
     ggatggtttg gtattcaagc caatgtatgt ggtgcagcat tctcacagtt tctaggtatt       360
     tatggaatta atcttccagt accagtttct tccttaattt ggggagttat catgttactt       420
     tcagctattt atggtattcg tattttgagt attttaaatt atatcgcagt accagtttta       480
     ctatttgtat gtatttacgg acttgttgtt tctttaaacg atggcggact agctattgtt       540
     gaaaattata aaccagcagg aagcatgtcg tttatgacag gactagcaat tacaattggc       600
     tcatttgcat taggtgcagt aatagcagga gactattctc aatatacaaa atcgcgtaaa       660
     gatgttgtaa aagcagctat tgtcgggatt ttgccatcag gtgtgcttat gattacggtt       720
     ggagcggtac ttgcacttac ggcgggtaca gcagatattt ctgtcgtatt tacaaactta       780
     ggattaccag ttcttggtat tatcggtttg atacttgctg catggacaac aaacgcagta       840
     aatgcctttt cgggaggtat tgcgattatc aatgtattta acatctctga aaaatatcac       900
     aaagtagcag tggcagttgc aggcggactt ggaacaatac tcgcggttat cggaatttta       960
     aaccactttg ttccaattat gtccgtactt tcagcaatgg taccacccgt tgcaggagta      1020
     atgattgctt cttactggat tgtccaaaaa ggtgacaaat ccaaatgggc accagtatca      1080
     ggtgtcaact ggcttggtgt aagttcttgg ctagttggtg cagtcattgc ggggattcca      1140
     gtcattttga catttttccc ggagctacca caattaccaa atcaaccact tatcggtatt      1200
     atcttgtcgc tggctgttta cttgatcgga gcgaaagtgc tgagcgggaa aaccaacaat      1260
     gtagaaaact tggagggaaa ataa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page