(data stored in ACNUC10821 zone)

EMBL: AE017262.PE483

AE017262.PE483       Location/Qualifiers
FT   CDS_pept        507262..508362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0471; match
FT                   to protein family HMM PF06032"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03273"
FT                   /protein_id="AAT03273.1"
FT                   /translation="MRYLDEQAIENIAIGAAFLGTGGGGDPYIGKMMALTAIKKHGPIK
FT                   LLSPEEIADDDYFIPAAMMGAPSVLIEKFPKGDEFVRVFEKLGRYVGKEVKGTFPMEAG
FT                   GVNSMIPIVVAAQLGLPMVDCDGMGRAFPELQMVTFHLDGISATPMAITDEKGNIGIME
FT                   TIDNKWTERLARVTTVEMGASSLVSLYPCNGAQIKQSSIKNIVTLSEEIGKVIRETSMD
FT                   EAEKLQKLLDVTHGYHLFEGKITDVVRETRAGFNFGRVKIDGLNKDTGSEVIVHFQNEN
FT                   LVAEKNGEPIAITPDLICMVDLETLMPVTTEALKYGKRVRVMALPADDAWRTDKGIETV
FT                   GPRYFGYDVDFEPLEELVKKEERRHV"
     atgcgttatt tagatgaaca agctattgaa aatatcgcga ttggtgctgc gtttcttggc        60
     actggtggcg gaggagatcc atatataggc aagatgatgg cattaactgc aattaaaaaa       120
     catggaccaa ttaaactgtt atccccagaa gaaattgcgg atgatgatta tttcattcca       180
     gccgcgatga tgggggcacc gtctgtactc attgaaaaat ttcctaaagg cgacgaattc       240
     gttcgtgtat ttgaaaaatt aggtagatat gtaggcaaag aagtaaaagg aacatttcca       300
     atggaagctg gtggagtaaa ctcaatgatc ccaatcgttg tggcggctca actaggtttg       360
     ccaatggtgg actgtgacgg catgggccga gcttttccag aactacaaat ggtgacgttc       420
     catctagacg ggatttccgc aacaccaatg gctatcaccg atgaaaaagg taatattggc       480
     atcatggaaa cgattgataa taaatggacc gaacgacttg cacgtgtgac aacggtcgaa       540
     atgggcgcga gttctcttgt gagcctgtat ccgtgtaacg gcgcgcaaat caagcaaagt       600
     agtattaaaa atatcgtgac gctatctgaa gaaatcggta aagtaatccg tgaaacttcg       660
     atggacgaag cagaaaaact acaaaaatta ttagatgtaa cgcacggtta tcatttattc       720
     gaagggaaaa ttaccgatgt agttcgggaa acgcgtgcag gcttcaactt tggtcgtgtg       780
     aaaatcgacg gactaaacaa agacacaggt agcgaagtca ttgttcattt ccaaaacgaa       840
     aatcttgttg cggagaaaaa tggcgaaccg atagcaatta caccagattt aatttgtatg       900
     gtagaccttg aaacgctgat gccggtaacg acggaagcgc tcaaatacgg aaaacgtgtc       960
     cgcgtgatgg cactaccagc tgatgatgct tggagaacgg acaaaggtat cgaaacagtt      1020
     ggaccgcgct atttcggcta tgatgtcgat tttgaaccac tagaagaact tgtcaaaaag      1080
     gaggaacgcc gtcatgtata a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page