(data stored in ACNUC10821 zone)

EMBL: AE017262.PE484

AE017262.PE484       Location/Qualifiers
FT   CDS_pept        508355..509905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0491"
FT                   /product="hydantoinase/oxoprolinase family protein"
FT                   /note="identified by match to protein family HMM PF01968;
FT                   match to protein family HMM PF05378"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03274"
FT                   /protein_id="AAT03274.1"
FT                   /translation="MYKIGIDVGGTNTDAVILDENQQLIHSVKMPTSEDIETGITESLH
FT                   RVLSETGIDRSKVTHAMLGTTQCTNAIVERKKLAKVGVLRLGYPATASVLPYTAWPEDM
FT                   VGFLSGKYKLTGGGYEYDGQVLSEINEAEIRETLASWKGEVESVAVVGVFSSLKNDQEL
FT                   AVQKIIEEELGADIPVSISSSVGSVGLIERENATILNAALFKVIAATSDGFEKALEQEG
FT                   IAHAEIYLCQNDGTLMSLNYARQFPILTIACGPTNSIRGASYLAGLKDAMVLDVGGTTS
FT                   DIGVLTDGFPRESSLAVDVGGVRTNFRMPDIISIGLGGGSIVREKDGDITIGPDSVGYR
FT                   ISEEALVFGGKTMTTTDIAVRLGRAEIGNPELVAHIPTDFAEKAYKKIAEMTEDAIDKM
FT                   KTSSGSVSLVLVGGGSVIIPDEISGVAQIFRDKNGPVANAIGASISQISGQYEQIYIYS
FT                   QIEREEALQDAEQKAREQATLAGAVTDSIEVVEVEEIPLAYHPGNATRLRVKVVGNLV"
     atgtataaaa ttggaattga cgttggtggt acaaacaccg atgccgttat tttagatgaa        60
     aatcaacaac tcattcatag tgtaaaaatg ccaacgagtg aagatattga aacaggaatt       120
     actgagtcac ttcatcgcgt attgagcgaa acgggcattg atcgctcgaa agtaacgcac       180
     gccatgcttg gaacaaccca gtgtacgaac gcgattgtag aacgtaaaaa attagcaaaa       240
     gttggcgttc ttcgtttagg ctatcctgca acagcatccg ttttaccata tacagcttgg       300
     ccggaagaca tggttggctt tttatctgga aaatataaat taactggtgg cggctatgag       360
     tatgatggtc aggtgctatc agaaatcaac gaagcagaaa tccgtgaaac cttagctagt       420
     tggaaaggtg aagtggaatc cgtcgcagtt gttggcgtct tttcttcctt gaaaaacgat       480
     caggaattag ctgttcaaaa aattattgaa gaagaactag gcgcagatat tccggtttcg       540
     atttcctctt ccgtaggttc tgttggactg attgaacgcg aaaatgcgac gattttaaac       600
     gcagcccttt tcaaagttat tgcggcaacg agtgatggtt ttgaaaaagc actagaacaa       660
     gaaggaattg cgcatgctga aatctatctt tgccaaaacg acgggacttt aatgtcacta       720
     aactatgcaa gacaattccc gattttgaca attgcttgtg gaccaacgaa cagtatccgc       780
     ggcgcatcct atttggcggg acttaaagac gcgatggttc tcgatgttgg tggcacgact       840
     tctgatattg gagtgctgac ggatggtttc cctagagagt cctcgcttgc ggttgatgtt       900
     ggcggagtgc gtaccaactt tagaatgcca gatattattt ccatcggact tggtggagga       960
     agtatcgttc gcgaaaaaga tggcgacata acaatcggac cagatagcgt tggctaccgt      1020
     atttccgaag aagcactagt tttcggaggt aaaacgatga ccactaccga catcgcggtt      1080
     cgtctaggta gggcagaaat cggtaaccct gaattagtcg cacatatccc aaccgatttt      1140
     gccgaaaaag cctataaaaa aattgctgaa atgaccgaag atgcgattga taaaatgaaa      1200
     accagttcgg ggagtgtaag tctagtactt gttggcggtg gtagcgtgat tattccagac      1260
     gaaatctctg gtgtcgcaca aattttccgc gacaaaaacg gcccagtagc caacgcaatc      1320
     ggcgcatcca tttcccaaat cagcggacaa tacgaacaaa tctacatcta ttctcaaatc      1380
     gagcgggaag aagcgctcca agatgccgaa caaaaagcga gagaacaagc aactctagcc      1440
     ggtgcagtga ctgactcgat tgaagtggtg gaagtggaag aaatcccatt agcgtatcat      1500
     ccgggtaatg caaccagatt gcgcgtgaaa gttgtgggaa atttggttta a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page