(data stored in ACNUC10821 zone)

EMBL: AE017262.PE485

AE017262.PE485       Location/Qualifiers
FT   CDS_pept        complement(510079..510306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03275"
FT                   /protein_id="AAT03275.1"
FT                   /translation="MFFARYSGTYALSIITSFGLLPNPKKSCEKYGTNGNISIDLEVND
FT                   ARQAFVRFLYSFIYPTRIFLVSVWVVFLDN"
     ttgttttttg cgcgctattc aggcacatat gctttatcta taataacatc tttcggacta        60
     ctacccaatc caaaaaagtc atgtgaaaaa tacggaacaa acggtaatat ttcaattgat       120
     ttagaagtga atgacgcgcg gcaagctttt gttcggttcc tttattcatt tatttaccct       180
     actagaatat ttttagttag cgtttgggtt gtttttctag ataattag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page