(data stored in ACNUC10821 zone)

EMBL: AE017262.PE486

AE017262.PE486       Location/Qualifiers
FT   CDS_pept        510541..512079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0493"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03276"
FT                   /protein_id="AAT03276.1"
FT                   /translation="MREYLDSKSQKKVALLEKIFYAENHTSTQEELLNDLNITYPTLIS
FT                   TIKTINFDIERFGYKAFSIVHSAPNLSYTLKISDNCSIQLIINAYIRESPKFQILETLL
FT                   LASFPNLQALAKKVHVSYSGIKKEIKELNEELSERNLYISTGNQVEITGDEFSLRIFYT
FT                   FLFLVAYSGDRWPFSFVRYDEITDLLESCPKEIYRANSIDKAMMIHYYVAMHLLRDRMN
FT                   CQIDTTRQFKVALYKACTEESKKSESAFIKKVAKQLPNRNYKEMTYTTQIILSTIVAFG
FT                   SYSSIEKMPSFFYMDEQLEEMGFMKLVDFASERVNDNLSIPFSEKEMELLRYSFASINY
FT                   RYFLLDNLINKFNNIVPGYTDLDRNIRKIHKVNHLEPLISQLVNLKEMDSLKPFEERLA
FT                   SDYLIILDKRIDFSIHTLPIKVTILSTISNETAVFDFMRYFSSYYNLEILNQVDPVVDL
FT                   YISDFSVSPEVLTSLRINQPIIYVNTRWLESDYVKINDNLAKIARKKFIANKKD"
     atgagagaat atttagattc aaaaagccaa aaaaaggtag cgcttcttga gaagattttt        60
     tatgcggaaa atcatacaag tacacaagag gaactattaa atgatttgaa cattacgtat       120
     ccaaccctca tttctacgat taaaacaatt aattttgata ttgaacgatt tggatacaaa       180
     gcgttttcga ttgttcactc cgcgccaaat ttgtcctata ccttaaaaat atcggataat       240
     tgtagtattc aactcattat caacgcctat attagagaat cgcccaaatt tcaaattctc       300
     gaaactttat tgctggcttc cttccctaat ctacaagcat tggcaaaaaa agtacatgtt       360
     tcttattctg ggataaagaa agaaataaaa gaattgaatg aagagctaag tgaacggaac       420
     ttgtatattt ctacaggaaa tcaggtagaa ataacggggg atgaattttc attaagaata       480
     ttctatacct tccttttttt agtcgcatat agcggggatc gttggccatt ttcttttgtt       540
     cgatatgatg aaatcactga cttattagag agttgtccaa aagaaattta tagagcaaac       600
     tcgatagata aggcgatgat gattcattat tatgtcgcta tgcatttatt aagagatcga       660
     atgaattgtc aaattgatac aactaggcag tttaaagtgg ccctatataa ggcttgcacc       720
     gaggagtcta agaaatcaga aagtgcgttc attaaaaagg tagcgaaaca acttcctaat       780
     aggaactata aagaaatgac ctacacgacg caaattatac tgagtaccat tgttgctttc       840
     ggtagttatt cttcgattga aaaaatgcct tcctttttct acatggatga acagttagaa       900
     gaaatgggct tcatgaaact agttgatttt gccagtgaac gagtaaatga taatctctct       960
     attccatttt cagagaaaga gatggaattg ctccgttact cctttgcgag tataaattat      1020
     agatatttct tacttgataa tttaatcaat aagttcaata atattgtgcc agggtataca      1080
     gatcttgatc gaaatataag aaaaatccat aaagtgaatc acctagaacc attgattagt      1140
     caattagtaa atttaaaaga aatggattca ttaaaaccgt ttgaagaaag acttgcttca      1200
     gattatctga tcattttgga taagcggatt gatttttcta tacacacctt gcctattaaa      1260
     gtaactattt tatcaactat atctaatgaa acagccgtat ttgattttat gaggtatttt      1320
     tctagttact acaatctgga aatacttaat caggtcgatc cggtggtgga cttatatata      1380
     agtgattttt ccgtgtctcc agaagtattg acctctttac gtatcaatca gccaataatc      1440
     tatgtaaata ctagatggct agaatctgat tatgtcaaaa ttaatgataa tctggcgaaa      1500
     atagcgagaa aaaaatttat cgctaataaa aaagattag                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page