(data stored in ACNUC10821 zone)

EMBL: AE017262.PE488

AE017262.PE488       Location/Qualifiers
FT   CDS_pept        514631..516700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0495"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM TIGR02167;
FT                   match to protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03278"
FT                   /protein_id="AAT03278.1"
FT                   /translation="MKKLSIRVILIVTIIFIACGSANVSIAQERDIINKLPEVELGSLY
FT                   TSNLITEEVAQDKPAEVENLEQAPTTDDLVQNPDVLEQPIADSDDSDLTVVNSGDFWTI
FT                   YRNTVNGEYSLHMFGNVPSSKPTAWNSYLNRIKHIEIEEATLTGNFSSYFRNNVFTVLE
FT                   SVRIERSNLSRVTSFALAFYGSGIEKVIIRDNNYPTAPSLLTTEGMFKNCSNLMEVDLS
FT                   GLDTSAVTTMWDMFNSCRALEELDVSHFDTSSVTNMSYMFYDNRNLEVLDVSNLDTGSV
FT                   TNMYAMFEDCTSLEELDVSNFDTSSVTDMYRVFNGCEKLKKLDVSNFDTSSATAMVQMF
FT                   RNCSALEKLDVSNFNTSLVTDMRAMFAGCTSLEALDVSNFDTSSVTNMAAMFSDNEKLE
FT                   KLDLSTFDTSSVTNMGTMFKNCTALKSLFLDNFTHAASSTDMFTGTTSLSYLFVSHNVS
FT                   NFNGLENTNWYDEKNWVQFSNLSQLQTYHRKQSEPTGYRKGAFLSLTMDAMGGEFEDAK
FT                   EQKVQSKISGEYWEEVIPVKEGHYFDGWYLDQNFTNKFDFSLPAAVSTTIYAKWVENYT
FT                   VVIPASISLNEASELKVEGINRGSKTLSVGLNYEETTISESNKLTLANTADTTVQCLAP
FT                   LSWDGSETNPEKAILTLAPGSEITEGDAVMAIEAPENIQAGKYTGNVVFSIKYE"
     atgaagaagc tttccatacg agtcatccta atcgttacca ttattttcat tgcttgtggg        60
     agcgctaatg tttctatcgc acaagaaagg gatataataa ataaacttcc agaggttgag       120
     ctgggttctc tttatacctc taatctcatt acagaagaag tcgcgcaaga caaaccggca       180
     gaggtcgaga atctagaaca agccccaact acggatgatt tggtgcaaaa tccagatgtt       240
     cttgagcagc ctattgccga ttcggatgat tcggatttaa cagtagtaaa ctcaggtgat       300
     ttttggacaa tttatcgtaa tactgtgaac ggtgaatata gcttgcatat gtttggtaac       360
     gtgccaagta gtaaaccaac cgcttggaat agttatttga acagaattaa acatatagag       420
     attgaagaag ctactttgac aggaaatttc tcatcgtatt ttagaaataa tgttttcaca       480
     gtacttgaga gtgtgagaat tgaacgttcg aatctatcta gagtgacgtc ttttgcactc       540
     gcattttatg gttcaggaat tgaaaaagtt atcattagag ataataatta tccgacagca       600
     ccatctttac tcactacgga aggtatgttt aaaaattgtt ccaaccttat ggaggttgat       660
     ttgagtggtc ttgatactag tgcggtaact actatgtggg atatgtttaa cagctgtagg       720
     gcacttgagg aactggatgt aagtcatttt gatacgagtt cagtaactaa tatgtcttac       780
     atgttttatg ataatagaaa ccttgaggtg ctggatgtaa gcaaccttga taccggttca       840
     gtaactaata tgtatgccat gtttgaagat tgtactagtc ttgaagagct ggatgtaagt       900
     aattttgata cgagttcagt aactgatatg tatagagtgt ttaatggctg tgaaaaactg       960
     aagaaactag atgtaagtaa tttcgatacc agttccgcta ctgcaatggt tcaaatgttt      1020
     agaaattgta gcgcccttga gaagttggat gtaagtaatt ttaatacgag cttagtaact      1080
     gatatgcgtg ccatgtttgc tggttgtact agtcttgaag cgttagatgt aagtaatttt      1140
     gatacgagtt cagtaactaa tatggctgcc atgttttctg ataatgaaaa actggagaag      1200
     cttgatttaa gtacctttga taccagttca gtgactaaca tgggtaccat gtttaaaaat      1260
     tgtacagcgt taaaatcttt atttctagat aattttacac atgcagcaag ctcgacagat      1320
     atgtttactg gaacaacctc tttatcttac ttgtttgtca gtcacaatgt aagcaatttt      1380
     aatgggttag aaaatacaaa ctggtatgac gaaaagaatt gggtacagtt ttctaatctc      1440
     tcgcaactac agacatatca ccggaaacaa agtgaaccta caggctacag aaaaggcgct      1500
     ttcctttctc taacaatgga tgcgatgggt ggagaatttg aagacgcgaa ggaacaaaaa      1560
     gtacaaagta aaatttctgg ggagtactgg gaagaagtga ttcctgtaaa agaaggacat      1620
     tactttgacg ggtggtatct tgatcaaaat ttcactaata agtttgattt ttccttgcca      1680
     gctgctgtat ctacaactat ctacgccaaa tgggtagaaa attatacggt ggtcattccg      1740
     gcttctattt ctttaaatga agcttccgaa ttgaaagtag aagggattaa tcgagggagt      1800
     aaaaccttat ccgtaggctt gaattatgag gaaacaacca tttctgagag caacaagcta      1860
     accttggcca atacggcaga cacaacagtc caatgtttgg caccactgag ttgggacggg      1920
     tcagaaacta atccagaaaa agccatttta acccttgccc caggttcgga aataacagaa      1980
     ggcgatgcag tcatggctat tgaagcacca gagaatatcc aggcaggaaa atatacaggg      2040
     aacgtcgtgt tttcgattaa gtatgaatga                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page