(data stored in ACNUC10821 zone)

EMBL: AE017262.PE489

AE017262.PE489       Location/Qualifiers
FT   CDS_pept        516766..517239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03279"
FT                   /protein_id="AAT03279.1"
FT                   /translation="MKKKRVVIISLLLLLVSVIGISSYFLFKDKINLLDVDHSAVDWNG
FT                   KKQKDTSGEENTIAIPGFEKVTLYANETKQAVNFHNPEINDCYFKISLIHPDGSVLWIS
FT                   DLIEPGKGMYSIELEKTLAVGEYENAVLKYECFSLNDQSPLNGSEINLKLVVV"
     atgaagaaga aaagagtagt gatcatatcc ttactactat tgttagtaag tgtcattgga        60
     atcagtagtt attttctatt caaggataaa ataaatctgt tggatgtaga ccattctgcc       120
     gttgattgga acgggaaaaa acagaaggat acaagtggag aagaaaatac aatcgccatt       180
     ccagggtttg aaaaagtgac gttgtatgca aatgaaacaa aacaagcagt gaatttccat       240
     aatccggaaa ttaatgattg ttacttcaaa atatcgctta ttcatccgga tggttcggtt       300
     ctatggatat ccgatttaat cgaaccagga aaaggtatgt attccattga attagaaaaa       360
     acgttagcgg taggcgaata tgaaaatgca gtattaaaat atgaatgttt ttctttaaac       420
     gatcagtcac ctttaaacgg gtctgaaata aatttaaaat tagttgtcgt ctag             474
//

If you have problems or comments...

PBIL Back to PBIL home page