(data stored in ACNUC10821 zone)

EMBL: AE017262.PE49

AE017262.PE49        Location/Qualifiers
FT   CDS_pept        53519..54178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0051"
FT                   /product="DedA family protein"
FT                   /note="identified by similarity to SP:P09548; match to
FT                   protein family HMM PF00597"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02839"
FT                   /protein_id="AAT02839.1"
FT                   /translation="MDFITYIIDFILHIDQHLVEIINNFGIWTYIILFLIVFIETGLVV
FT                   FPFLPGDSLLFAAGALSVLDGSILHIVPLIITLWLAAVLGDTVNYHIGKKIGTSIPEDS
FT                   WFGKLINKEKMEKAEAFFNKHGGKTIFIARFMPFIRTFAPFVAGASRMNYRYFLNYNIL
FT                   GATVWVLLCTLAGYFFGNFPIVKDNFSLVVIGIIVVSVIPMVVSFIKSKMDKKSAE"
     gtggatttta ttacctatat cattgatttt attttgcaca ttgaccaaca tttagtggag        60
     attataaata attttggaat ttggacttac attattttgt tcctgattgt ttttatagag       120
     actggattgg tagtatttcc atttttacca ggagattcat tactattcgc agccggtgca       180
     ttatctgtat tagatggttc gattttacat attgttccgc taattattac tttatggtta       240
     gcagcagttc taggcgatac agtgaactat catatcggta aaaagattgg aacatccata       300
     ccagaagata gctggtttgg gaaactaata aataaagaaa aaatggaaaa agcggaggcg       360
     ttcttcaata aacatggtgg aaaaacaatt tttattgcta ggttcatgcc ttttattcgc       420
     acgttcgcgc catttgtagc tggagcaagc cgtatgaatt atcgttattt cttaaattat       480
     aatattttag gggcaactgt ttgggtatta ctttgtacgc tcgcgggtta cttcttcggg       540
     aacttcccaa tcgttaaaga caacttctcg ttagtagtaa tcggaattat cgtagtttcc       600
     gttatcccaa tggtagtttc gttcattaaa agtaaaatgg acaaaaaaag cgcagaataa       660
//

If you have problems or comments...

PBIL Back to PBIL home page