(data stored in ACNUC10821 zone)

EMBL: AE017262.PE494

AE017262.PE494       Location/Qualifiers
FT   CDS_pept        519153..519770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0501"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03284"
FT                   /protein_id="AAT03284.1"
FT                   /translation="MLMSLSVLPLATYASETENTPTESYGGENFIATQTGNTLVIEDKK
FT                   TGETVKIEMNDEENGVITSDDGTIENVHRDEEGNVYVDNELELEAPPLDIEDGINIATQ
FT                   PRLLKASKWIYVQTTKYNTTTQGNMRSLALGILSFMPITGPIFGIVAIIDAARSMGAKT
FT                   LYVRVKQYRTSGYQFYKYDSYYYANASLTKLVKKTSQTKRMW"
     atgttaatgt ctctttcggt tctgccactg gcaacttatg catcagaaac agagaacact        60
     cctactgaat catatggcgg agaaaatttt atagcaaccc aaacaggtaa tactttagtt       120
     attgaagata agaagacggg cgaaactgta aaaattgaaa tgaatgacga agaaaacggg       180
     gtaattacat ctgatgatgg tacaatagaa aatgtacata gggatgaaga aggtaacgtt       240
     tatgtagata atgagcttga actagaagca cctcctttag acattgaaga tggcataaat       300
     atcgccactc agcctcggtt actgaaagct tctaaatgga tatatgttca aacaactaag       360
     tataatacaa ccacacaagg caatatgaga agtcttgcat tggggattct atcattcatg       420
     ccaattacag gtccaatctt tggaatagtt gcaattattg atgctgctcg atcaatgggg       480
     gcgaaaacat tatatgttag agtgaaacaa tatcgtacta gtggttatca attttataag       540
     tatgattctt attattatgc caatgctagt ttaactaagc tagttaaaaa aacatcccag       600
     actaaacgaa tgtggtag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page