(data stored in ACNUC10821 zone)

EMBL: AE017262.PE499

AE017262.PE499       Location/Qualifiers
FT   CDS_pept        523033..523392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0477"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03289"
FT                   /protein_id="AAT03289.1"
FT                   /translation="MKKYKKWWITIGIIFLLSVIGYVYWFAIPKNTANKAVGNYLAEQK
FT                   IKSNQIETRVIKKDWKMGGYLTKIVFKDDPNLKYEYSYDERYEFPHHIYVLVFKDGSSQ
FT                   EDDQVKHPPLQEQND"
     atgaaaaagt ataaaaaatg gtggataaca ataggtatca tattcctact tagtgttatt        60
     ggatatgttt attggtttgc gattcccaag aatacagcga ataaagcagt gggtaactat       120
     ctagcagaac aaaaaatcaa atctaatcaa attgaaacta gagtgataaa gaaagattgg       180
     aaaatgggtg gttatcttac aaagatagtt tttaaagatg atccaaatct aaagtatgaa       240
     tatagctatg atgaaagata cgagtttccg catcatattt atgtccttgt ttttaaagat       300
     ggctcgagtc aagaggacga tcaagtgaag catccaccac tacaagagca aaatgattaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page