(data stored in ACNUC10821 zone)

EMBL: AE017262.PE500

AE017262.PE500       Location/Qualifiers
FT   CDS_pept        523644..524204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0478"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03290"
FT                   /protein_id="AAT03290.1"
FT                   /translation="MAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYY
FT                   HFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASIL
FT                   SFCFSKLTNSLFMDLFEKIDTNGAVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPET
FT                   IANQLFRLAKDTEFLANSMYREN"
     atggcggaat cactcattac taaaaaagcg attgctggtg ggctgatgga gctttgtcag        60
     cataagcggt ttgaaaagat tagtattgcg gatatcacga atatttgtgg acttaatcgg       120
     caaacttttt actatcattt tacagataaa tacgatttgc ttacttggac gtatgaaaat       180
     gactttttcc attgtttggc ggatgggatt acgcttggaa attgggataa gcatgtgctg       240
     aaaatgctgg aatcgattaa agaaaatgct gatttctata aaaatacggt ttcggcggat       300
     gcaagtattc tttctttttg cttttctaaa ttaacgaatt cgctgtttat ggatttattt       360
     gagaaaattg atacgaatgg agccgtgaac gaggcggacc gggtatttta tgcggaattc       420
     ttttcttacg gatgctcggg tgtactgatt aaatggatta cgcgcggttt taaagaggca       480
     ccggaaacga ttgcgaacca gctatttcga cttgcaaagg atacggaatt tttagcaaat       540
     agcatgtacc gcgaaaacta g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page