(data stored in ACNUC10821 zone)

EMBL: AE017262.PE502

AE017262.PE502       Location/Qualifiers
FT   CDS_pept        526165..527268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0509"
FT                   /product="conserved hypothetical protein TIGR00048"
FT                   /note="identified by similarity to OMNI:NTL01LI0480; match
FT                   to protein family HMM PF04055; match to protein family HMM
FT                   TIGR00048"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03292"
FT                   /db_xref="GOA:Q723G9"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723G9"
FT                   /protein_id="AAT03292.1"
FT                   /translation="MEKSSIYGLTWTKLTEWLEAHGQKKFRATQVWDWLYRKRVKTFEE
FT                   MSNVPKETIELLTANFVMNTLEEQVVQESTDGTTKYLFKLSDGNLIETVMMKQEYGLSV
FT                   CVTTQVGCNIGCTFCASGLLKKSRDLTAGEIVEQIMNVQHYLDGRNLEERVSHVVVMGI
FT                   GEPFDNYDNVMDFLRVINHDKGLAIGARHITVSTSGLAPRIIDFANEDFQVNLAISLHA
FT                   PNNELRTSIMRINKTYSIEKLMEAIHYYVNKTNRRITFEYIMLKGVNDHKKEALELAAL
FT                   LGEHRHLAYVNLIPYNPVDEHIDYERSTKEDVLAFYDTLKKNGINCVIRREHGTDIDAA
FT                   CGQLRSKQIKRVGVRERMKQKQAAAEE"
     atggaaaaaa gctccattta tggattaaca tggacaaaat taacagaatg gctagaagca        60
     cacggtcaaa agaaattccg cgcaacacaa gtgtgggact ggctttatag aaaacgtgtc       120
     aaaacttttg aagaaatgag taacgttcca aaagaaacaa ttgaactttt aacagcgaat       180
     tttgtgatga acactttaga agaacaagtg gtacaagaat cgacagatgg cacaacgaaa       240
     tatttattta agctgagtga cgggaactta attgaaaccg tgatgatgaa gcaagaatat       300
     ggcttgtcgg tttgtgtaac gactcaagtt ggttgtaata tcggctgtac tttttgtgcg       360
     agtgggcttt tgaaaaaaag tcgcgactta accgctggcg aaattgtgga acaaattatg       420
     aatgtgcagc attatttgga tggacgtaat ttggaagaac gcgtgagtca cgtggttgta       480
     atgggaatcg gggaaccgtt tgataattac gataatgtga tggatttctt gcgtgtgatt       540
     aatcatgaca aaggcctcgc aatcggcgcg cgccatatca ctgtttcgac aagtggtctt       600
     gcaccgcgca ttattgattt tgccaatgag gatttccaag ttaacttagc gatttccctc       660
     catgcgccga acaatgaact gcggacgagt attatgcgta ttaacaagac ctattcaatt       720
     gagaaattga tggaagcaat ccattattac gttaacaaaa ctaaccgccg aatcacgttt       780
     gaatacatta tgctaaaagg tgtaaacgac cacaaaaaag aagcgctcga actggcggca       840
     cttctcggag aacatcgcca tttagcttat gttaacttga ttccttacaa cccggtggat       900
     gagcatatcg attatgaacg tagcacaaaa gaagacgtac tcgctttcta tgatacattg       960
     aagaaaaatg gtattaattg tgttattcgc cgcgaacacg ggacagatat tgatgctgcg      1020
     tgtgggcaac ttcgtagtaa acaaatcaaa cgagttggcg tgcgcgaacg gatgaaacaa      1080
     aaacaagcag cagcggaaga ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page