(data stored in ACNUC10821 zone)

EMBL: AE017262.PE503

AE017262.PE503       Location/Qualifiers
FT   CDS_pept        527358..527837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0481; match
FT                   to protein family HMM PF06445"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03293"
FT                   /protein_id="AAT03293.1"
FT                   /translation="MEVEIVERNAFTAVGKKRTFSVENDAQKEKISQFWQEANTNGDAE
FT                   RINELAEFATIDGILGVCKMNGDKMDYYIAIESELTPPADMEKLIIPASKWAIFKSVGP
FT                   LPSAIQKVWEYIYGEWFQTSNYAHGNAPELEVYTEGDTTAADYYSEVWIPVVEKE"
     atggaagtag aaattgtcga acgaaatgct tttacagctg tggggaaaaa acgaactttt        60
     tcggttgaaa acgatgcgca aaaagaaaaa atcagccaat tttggcaaga agcaaacaca       120
     aatggcgatg ccgaacgaat caacgaatta gctgaatttg caacaattga tggtatttta       180
     ggcgtttgta aaatgaacgg cgacaaaatg gactattata tcgcgattga atccgaactc       240
     actccaccag cagacatgga aaaactaatc atcccagcaa gtaaatgggc catcttcaaa       300
     tcagtcggcc cactaccaag cgcaatccaa aaagtgtggg aatacattta cggcgaatgg       360
     ttccaaacaa gcaactacgc gcacggaaac gctccagaac tagaagtcta cacagaaggt       420
     gacacaactg ccgctgatta ttattcggaa gtttggattc cggtggttga aaaagaatag       480
//

If you have problems or comments...

PBIL Back to PBIL home page