(data stored in ACNUC10821 zone)

EMBL: AE017262.PE507

AE017262.PE507       Location/Qualifiers
FT   CDS_pept        530778..531353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LM0480; match
FT                   to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03297"
FT                   /protein_id="AAT03297.1"
FT                   /translation="MIEKTIMERRSIKKANDAPISRETVNTILEQAAYAPFHSKVEPWN
FT                   VYVLHTLAEKERYIEKIIEFNEREQGVSFSEAEIADLKAGYAKKIITPPYLLIVTTNII
FT                   GHGKKDFESIGATSAFIQNIQLLGWEAGIGMIWRSNRFIFDAKFAEDLGIPSEQKIVGT
FT                   LHLTSLAEVPEAKPRRPLNEWVKNLADL"
     atgattgaaa aaacaattat ggaacgtcgt agcattaaaa aagcgaacga cgcgccaatt        60
     tcaagagaaa cggtgaacac cattttagag caagctgcct atgcgccttt tcatagcaaa       120
     gtagagccgt ggaatgtata cgtgctgcat acacttgctg aaaaagagcg atacatcgag       180
     aaaatcatcg aatttaatga gcgcgaacaa ggggttagtt tttctgaagc agagattgcg       240
     gatttaaaag caggctatgc gaagaaaatt attacgccgc catatttact cattgtgacg       300
     acgaatatta tcggtcacgg gaaaaaggat ttcgaatcaa tcggggcaac tagtgcattt       360
     atccaaaata tccaattact tggctgggaa gcgggaattg ggatgatttg gcggtcgaat       420
     agatttattt ttgatgcgaa gtttgcggaa gatttaggta tcccttctga gcaaaaaatt       480
     gttggaacct tgcatttaac tagcttagcg gaagtgccag aagcaaaacc gcgtcgtcct       540
     ttgaatgaat gggtgaagaa tttagccgat ttgtaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page