(data stored in ACNUC10821 zone)

EMBL: AE017262.PE511

AE017262.PE511       Location/Qualifiers
FT   CDS_pept        533536..535530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0519"
FT                   /product="NADH:flavin oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00724; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03301"
FT                   /protein_id="AAT03301.1"
FT                   /translation="MTDYPSIFEPLTVKRMTIKNRVIMPPMGTNLAGLNGEFLEEHMNY
FT                   YEQRAKGGTGLITIENACVDFPYGTNGTTQLRIDNDQYIPGFYKLTERLHKHGTCVSIQ
FT                   INHAGASAYPARLNGLQPVSASDIPSKKGGTVPRPLTVEEIYEIVNKYGDAARRAQQAG
FT                   FDAVEIHGGHSYLLCQFLSPLYNKRTDEFGGSPENRARIVKLILEKVRAEVGPFFPIVL
FT                   RFSADEFTEGGNHLEDILELLDYCQEEADILNVSAAINDNLYLQIDQMNLEDGWRSYLA
FT                   KAVKDKFNKPTITSGNIRSPKAAEKILSEGYADLLAMGRGLIAEPNWVNKVATGQEDML
FT                   RKCISCNIGCADHRISKSKPIRCTVNPDIIHEDKYKETKVTRPTNVVVIGGGTAGLEAA
FT                   CTAAEVGCNTTLIEASEQTGGLARAIANLPDKSRIADFPNYLANRAEKLTNLKVITGTK
FT                   ADTALIDTFNPDVVVNATGSKPLLPPIKGLHDVIDKEGSKVHSIFGLISNIDDFTEFSN
FT                   KKVAVIGGGAVGLDVVEYFSERGSDVTIVEMMPLLGKDLDMITRLSMMDIIEKNNVDVQ
FT                   TETALTEVAADHFKVKHDGVDAEIPFDYGFVCLGMRPERPLMEELAAYGKEKQIEIVNI
FT                   GDSAATRKILEGVREGRNILTTLEKIGSL"
     atgacagatt atccgagtat ttttgaacca ttaactgtaa aaagaatgac cattaaaaac        60
     cgtgtgataa tgccaccaat ggggacaaac ctagctggat taaatggcga atttttagaa       120
     gaacatatga attactacga acaacgcgca aaaggtggaa caggtctaat cactattgaa       180
     aacgcttgtg tagattttcc ttatgggaca aacggaacaa cgcaacttcg aatcgataat       240
     gaccaataca tccctggatt ttacaaatta acagaacgtc ttcataaaca tggaacttgt       300
     gtatccatcc aaatcaacca cgctggtgca tcagcttatc cagcacgttt gaatggactt       360
     caaccagttt ccgcgtcaga tattccatct aaaaaaggtg gtactgtacc gcgcccgctt       420
     acggtagaag aaatttatga aatcgtcaat aaatacggtg atgcagctag acgtgcccaa       480
     caagctgggt ttgatgcagt cgaaatccac ggcggacact cgtacttact atgccaattc       540
     ttatcgccac tttataacaa acgtacggat gaatttggtg gctcgcctga aaatcgcgcc       600
     cgtatcgtca aactaatttt ggaaaaagtc cgcgcggaag ttggtccatt tttcccaatc       660
     gtacttcgtt ttagtgcaga tgaatttaca gaaggcggca accacttaga agatattttg       720
     gaactgctag attattgcca agaagaagcg gatattttga atgtatcagc ggcaataaat       780
     gacaacctat acttgcaaat tgaccaaatg aacttggaag atggctggag aagctacctt       840
     gcaaaagcgg tgaaagataa atttaacaaa ccaacgatta cttccggtaa cattcgcagt       900
     ccaaaagcgg cagagaaaat tttgtcagaa ggatatgcgg acttgcttgc gatgggacgt       960
     ggcttaatcg ctgagcctaa ctgggtgaac aaagtggcaa ctggccaaga agacatgctt      1020
     cgaaaatgta tttcttgtaa tatcggttgc gcggatcacc gaatttccaa gtcgaagcca      1080
     atccgttgta cggtgaatcc tgatattatt catgaagata aatacaaaga aacaaaagtg      1140
     actcgtccga ccaatgttgt cgtaattggc ggcggaacag cagggcttga agcagcttgt      1200
     acggcggccg aagttggctg taacacaacg ctaattgaag cgagtgaaca aactggtggc      1260
     ttggcgcgtg ccattgccaa ccttccagac aaaagtagaa ttgccgattt ccctaattat      1320
     ttagcgaacc gagcagaaaa attaaccaat ttaaaagtta ttacaggcac taaagctgat      1380
     actgcgctta ttgatacatt taatcctgat gtggtagtca atgccacagg atccaaacca      1440
     ttacttccac cgattaaagg tttgcatgac gtgattgaca aagaaggcag taaggttcat      1500
     tcgatttttg gacttatttc aaatatcgat gactttaccg aatttagtaa caaaaaagtt      1560
     gcagttatcg gcggtggtgc agttggactt gatgtggtcg agtacttctc agaacgcggc      1620
     tcggatgtta caattgtaga aatgatgcca cttcttggaa aagacttaga tatgattaca      1680
     cgtctttcga tgatggacat tatcgagaag aataatgttg atgtgcaaac agaaactgca      1740
     ttaaccgaag tagcagcgga tcatttcaaa gtgaagcacg acggagtaga cgccgagatt      1800
     ccatttgatt acggctttgt ctgcctagga atgcgaccag aacgcccact tatggaagaa      1860
     cttgcggcat acggaaaaga aaaacaaatt gaaatcgtaa atattggcga cagcgctgcg      1920
     acaagaaaaa tcttggaagg cgttcgcgaa ggaagaaata ttttaactac attagaaaaa      1980
     attggctctt tgtaa                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page