(data stored in ACNUC10821 zone)

EMBL: AE017262.PE516

AE017262.PE516       Location/Qualifiers
FT   CDS_pept        540333..540926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0524"
FT                   /product="lipase/acylhydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03306"
FT                   /protein_id="AAT03306.1"
FT                   /translation="MKKLLFLGDSVTDAGRDFENDRELGHGYVKIIADQLEQEDVTVIN
FT                   RGVSANRVADLHRRIEADAISLQPDVVTIMIGINDTWFSFSRWEDTSVTAFKEVYRVIL
FT                   NRIKTETNAELILMEPFVLPYPEDRKEWRGDLDPKIGAVRELAAEFGATLIPLDGLMNA
FT                   LAIKHGPTFLAEDGVHPTKAGHEAIASTWLEFTK"
     atgaagaagt tgcttttttt aggtgatagt gtgacagatg cggggcgaga ttttgaaaat        60
     gaccgcgaat taggacatgg ttatgtgaaa ataattgcag accagcttga gcaagaagat       120
     gtaacggtta taaatcgtgg cgttagtgcg aaccgtgtgg cggatttgca tcgtcgtatt       180
     gaggcggatg caatttcact tcaaccagat gtagttacga ttatgattgg gataaatgat       240
     acgtggttta gttttagcag atgggaagat acttcggtga cggcgtttaa agaagtgtat       300
     cgtgtgattt tgaatcggat taaaacagaa acaaatgcgg aactcatttt gatggagccg       360
     tttgtattac catatccgga agatcggaaa gagtggcgtg gtgatttgga tccaaaaatt       420
     ggagctgtgc gcgaacttgc ggcagaattt ggtgcaacgc ttattccgct tgatgggcta       480
     atgaacgccc tcgctatcaa acatgggccg acctttttag ctgaggacgg ggtgcacccg       540
     accaaagcag gacatgaagc aattgcctct acttggttag aatttacaaa ataa             594
//

If you have problems or comments...

PBIL Back to PBIL home page