(data stored in ACNUC10821 zone)

EMBL: AE017262.PE517

AE017262.PE517       Location/Qualifiers
FT   CDS_pept        541112..542071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0525"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03307"
FT                   /protein_id="AAT03307.1"
FT                   /translation="MQKEKAPIGLYFLLIAVMASWGFNVTMTKVLVSYFPTVTMTSFRI
FT                   FTAAITVIIILFITKKLRLPTKREFGLIFLASIFNIVIHHFFLSNGLKLTTGTNAGLIL
FT                   GSAPIVVAIFSVVFLRERIGAWRALGFLAGIFGVSLVVLSNGTGISGISLGDIDIFIAM
FT                   ASQAFSFIIIKKLAGSMDTGLMTGYMLFLGSVMLFGLSRFMEPGGMSELVAVHSWKLWL
FT                   LFVVSAVVATAFGNFVYNYAVGKIGPSRSAIFMNFNPLFSLIGALLFLGEAIKIPQLVG
FT                   FGFIIIGVLLGSGALMDLIYERKKTKVRDPEKLLEKEV"
     ttgcagaaag agaaagcacc gataggactt tattttttat taattgcagt gatggcgagt        60
     tggggtttta atgtcacgat gacgaaagta ttagttagct attttccgac tgttacgatg       120
     acatcttttc gaattttcac cgcagctata accgttatta ttattttatt tatcacaaaa       180
     aaattacgtc tgcctacaaa acgggaattt ggtttaattt ttctcgcgag tatttttaat       240
     attgttattc atcatttttt cttgtcgaac gggttgaagc tgacgactgg gacgaatgct       300
     gggcttattc ttggttctgc gccgattgtg gtggcgattt tttctgtggt ttttctccgt       360
     gaacgaattg gagcttggcg tgcgctcggc tttttagcag ggatttttgg cgtgagtttg       420
     gttgttcttt caaatgggac ggggataagc gggatttcac tgggagatat cgacatcttt       480
     atcgcgatgg cttctcaggc atttagtttt attattatta aaaagctcgc tggatcaatg       540
     gacacggggc tgatgactgg atatatgcta tttcttggtt cggttatgtt gtttggttta       600
     agtcgcttca tggagccggg tggcatgtca gaattagtgg cggttcattc atggaaactg       660
     tggctcttgt ttgttgtttc agctgtagtt gcaacggcat ttggcaattt cgtttataat       720
     tatgcggttg ggaaaattgg gccgtcacgc tcggctattt ttatgaattt caatccatta       780
     ttttcactaa ttggcgcatt acttttcctt ggagaagcaa ttaaaatccc ccagctagtt       840
     ggcttcggtt ttattattat tggcgtccta cttggttcgg gcgcattaat ggatcttatt       900
     tatgaacgca aaaaaacaaa agtacgcgat cctgaaaaac tgctcgaaaa agaagtttga       960
//

If you have problems or comments...

PBIL Back to PBIL home page