(data stored in ACNUC10821 zone)

EMBL: AE017262.PE520

AE017262.PE520       Location/Qualifiers
FT   CDS_pept        542983..543651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0528"
FT                   /product="ribulose-phosphate 3-epimerase family protein"
FT                   /note="identified by match to protein family HMM PF00834"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03310"
FT                   /protein_id="AAT03310.1"
FT                   /translation="MKMIAASIMCADSLHLADELRALEQANVKMLHCDVMDGVFVENAA
FT                   MGAYVLQDIKNNTDMLLDIHLATVNPDRFVDLYAAIKPAYMSFHVEASPDVDATIKHIR
FT                   ALGIKPSIAISPDTEIEQIYPFLDKVDMVLMMTVNPGFAGQKFQHHVLEKIKKLQRELE
FT                   SHTNKPLIEVDGNIFEETVRLLEPIGADVYVVGTAALFNDKAGSYTEKLAPLREIIQER
FT                   "
     atgaaaatga ttgcggcttc cattatgtgt gcagactcgc ttcatctcgc tgacgaactt        60
     cgcgcactcg aacaagcaaa tgtaaaaatg ctccattgtg atgtgatgga tggtgttttt       120
     gtagaaaatg cagcaatggg cgcctatgtc cttcaagata taaaaaacaa tacagatatg       180
     ctactagata tccacttagc tacagtgaac cctgatagat ttgtggattt gtatgcggcg       240
     ataaagccgg cttatatgtc tttccacgta gaagcttcac ctgatgtcga tgcgactata       300
     aagcatattc gtgcgctagg aatcaaaccg tccatcgcca tcagcccgga tacagagatt       360
     gaacagattt atccattttt agataaagtc gatatggttt taatgatgac cgttaaccca       420
     ggattcgccg gacaaaaatt tcagcatcat gtcctagaaa aaatcaagaa acttcaaaga       480
     gagcttgaaa gtcacaccaa taaaccatta attgaagtag acggtaatat ttttgaagaa       540
     acagttcggt tgcttgaacc aattggcgca gatgtctatg tcgttggaac agccgcatta       600
     tttaacgaca aggcaggtag ttatacagaa aaattggcgc cactcagaga aattatccaa       660
     gaaaggtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page