(data stored in ACNUC10821 zone)

EMBL: AE017262.PE521

AE017262.PE521       Location/Qualifiers
FT   CDS_pept        543658..544308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0529"
FT                   /product="putative transaldolase"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03311"
FT                   /protein_id="AAT03311.1"
FT                   /translation="MHLDSANLEDVKKIQASSIFKGITTNPTILVKEKCNRQTAINRIL
FT                   ELTDKQVFVQTVGFSYEEILADARMLLAMFGKEKIAIKIPAHEAGINVIDTLKKEDKTI
FT                   QILGTAIYSADQAIAAALAGADFVAPYVNRMSAANIDPFKEIAGMRHFFDKKALKTQIM
FT                   AASFKHSGQVMQAYESGADTVTIPYEIYLQMTNKVLAVEAIRVFNKDATLYEK"
     atgcatttag attcagctaa tttagaagac gtgaaaaaaa ttcaagccag ctccattttt        60
     aaaggaatta caacgaaccc aaccatttta gtaaaagaaa aatgcaatcg acaaacagcg       120
     attaatcgta ttttagaact tacggataaa caagtttttg tacaaacagt tggttttagc       180
     tatgaggaaa ttttggcaga tgcgcgcatg ttactagcga tgtttgggaa agaaaaaata       240
     gctattaaga ttccggcaca tgaggctggt attaacgtga tcgatacact caaaaaagag       300
     gataaaacca ttcaaatctt agggactgct atttattcgg ctgatcaagc aatcgcggct       360
     gccttggctg gtgcagattt tgttgcccca tatgtgaata ggatgagcgc agcgaacatc       420
     gatcctttta aagaaattgc tgggatgcgt cacttttttg ataaaaaggc acttaaaaca       480
     caaattatgg cagcgagctt taaacatagt gggcaagtaa tgcaagccta cgaaagtggc       540
     gcagatacgg taactattcc ttatgaaatt tatttgcaaa tgaccaataa agttttagca       600
     gtagaagcaa ttcgtgtctt taataaagat gctacattgt acgaaaagta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page