(data stored in ACNUC10821 zone)

EMBL: AE017262.PE524

AE017262.PE524       Location/Qualifiers
FT   CDS_pept        547111..547578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0532"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03314"
FT                   /protein_id="AAT03314.1"
FT                   /translation="MDVLEYFKEEMVRFSNEQDKEKLLSEMAEQLCEVGAVKPSYKDAV
FT                   IKREKVFPTGLLTAHAGVAIPHTDSEHVIRPVVAVRILKKPVSFIEMASDNEAIDVRIV
FT                   FMMALRSADEQLDMLQTLIQLIQDEEVMTTLLKAQETGDVLSAIEHFSKNN"
     ttggatgtat tagaatattt taaagaagaa atggttcgat tttcaaacga acaagataaa        60
     gaaaaattac tttcagaaat ggcggaacag ttgtgtgaag tgggcgcagt aaagccaagc       120
     tataaagatg cagtaattaa acgggaaaaa gtttttccaa ccggattact aaccgcgcac       180
     gccggggttg ccattccgca tacagatagc gaacatgtta ttcggccagt ggtggctgta       240
     cgaatactca agaagcccgt ttcatttatt gaaatggcct ctgataacga agcaatcgat       300
     gtcagaattg tctttatgat ggcgctaagg agtgccgatg aacaactaga tatgctgcaa       360
     acacttattc aacttattca agacgaggag gtgatgacga ccttacttaa agcgcaagag       420
     acgggagatg ttctttccgc aatagaacat ttttctaaga ataattaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page