(data stored in ACNUC10821 zone)

EMBL: AE017262.PE525

AE017262.PE525       Location/Qualifiers
FT   CDS_pept        547595..547993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0500"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03315"
FT                   /protein_id="AAT03315.1"
FT                   /translation="MGSFFASFVDWLIGSPGRFVVNLIEDNMLIFMFVVMIYATTILYA
FT                   KWTLAYYLPKKMNQLAEMKTWELDELYAAWQTEKKALPWYILVPSRNEFWVKSARNAPE
FT                   STKLLHFSQQKLKLSDKEKLQKIIEIQS"
     atggggagtt tttttgcaag ttttgtagac tggctaatag gaagtccagg tagatttgtc        60
     gttaacttaa ttgaagataa tatgttaatt ttcatgttcg tagtaatgat ttacgccacc       120
     accattttat acgccaagtg gacactcgca tactacttac cgaaaaaaat gaatcagtta       180
     gcagaaatga aaacgtggga gctggacgaa ttatatgcag cgtggcaaac agagaaaaaa       240
     gctctaccgt ggtacattct cgtgccaagc cgaaatgaat tttgggtaaa atcagcccga       300
     aatgcaccag aatcaactaa attactccat tttagtcaac aaaaattaaa actaagtgac       360
     aaagaaaagt tacaaaaaat catagaaatt caatcttga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page