(data stored in ACNUC10821 zone)

EMBL: AE017262.PE527

AE017262.PE527       Location/Qualifiers
FT   CDS_pept        548651..549697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0535"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03317"
FT                   /protein_id="AAT03317.1"
FT                   /translation="MKALKLYGKRDLRYEEADMPTIEQPDDVILKVKTVGICGSDISRY
FT                   SKLGPYVPGMVWGHEFSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCR
FT                   KLTVIGARHPGAYAEYIKLPAENVVKIPDELDYEAAALVEPSAVVVHGFYHTKLQAGDD
FT                   VVVVGSGNIGLLAIQWAKVFGAKRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVA
FT                   AHTDGLNADLVVEAAGSPITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSEL
FT                   TVWGSWNAISAPFPGKEWQTTIHFLANKQINIEPMITHRLSLAEGPEVFERIYERNEFF
FT                   GKVLFFPE"
     atgaaagctt taaaattata tggaaaaaga gatttgcgtt atgaagaagc ggatatgcca        60
     acaatcgaac agccagatga tgtgattttg aaagtgaaaa cggttgggat ttgcggatct       120
     gatatttcga gatacagtaa acttggtccg tatgtaccag gaatggtgtg gggacatgaa       180
     ttttcaggag aagtgattga ggttggtagt gaggttacag atattgagat tggtgatagg       240
     gctgccggat gcccagcact ctattgcgga gagtgtgaat actgtaaaaa aggcgaattc       300
     gcccgctgtc ggaagctaac agtaatcgga gcaagacatc ccggagccta tgctgagtat       360
     atcaaacttc cagcagaaaa tgtagtaaaa ataccagacg aattagatta tgaagctgct       420
     gcacttgtcg agccttccgc agtggtcgtt catgggtttt atcatacgaa attacaagca       480
     ggcgatgatg tcgtcgttgt cggaagcggc aatataggtt tgctagcaat tcaatgggca       540
     aaagtttttg gcgcaaaaag agttattgca attgatgtag acgataaaaa gttagctctt       600
     gcaaaagaag taggagcaga cgtcgttatt aattctttaa aagaagatcc attagaagta       660
     gtcgcagcac atacagatgg tctaaacgct gatttagttg tagaagctgc gggatcacct       720
     attacatctg cccaagtttt tgcctatgcg aaaaaaggtg gaggcgtcgt tttcctaggg       780
     attccatacg ccgatgtaac aatcgaacgt ttctattttg aaaaaattgt tcggagtgag       840
     cttactgttt ggggctcatg gaatgcaatt tctgcaccat ttccaggaaa agaatggcaa       900
     acaaccattc atttcctagc caataaacaa atcaacattg aaccaatgat tacacatcgt       960
     ctttcacttg ctgaaggacc agaagttttt gagcgaatct atgaaagaaa tgaatttttc      1020
     gggaaagtat tatttttccc agaataa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page