(data stored in ACNUC10821 zone)

EMBL: AE017262.PE529

AE017262.PE529       Location/Qualifiers
FT   CDS_pept        550021..551292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0537"
FT                   /product="putative PTS system, galactitol-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P37189; match to
FT                   protein family HMM PF03611"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03319"
FT                   /protein_id="AAT03319.1"
FT                   /translation="MDIILDFFKYIIGLGVTVMMPIIITILGVIFRKKISVAFKAGLTV
FT                   GVGFVGLGVITSLMLTTITPVTKALVENYNFKLTATDIGWGVGSSLAWGTEVVPFVFVA
FT                   IIATNILMIAFKWTKTMDVDIWNYWQPLFIASALYLTTGSMIIAILSSIINMAIIFKIA
FT                   DWTQKDVENVLGLEGISLPQIQTTGWALVGYPMNWLLGKIPGVRKINWSTEKVQSRLGI
FT                   FGEPMLMGLIIGGGLAAIAQMPLSQVLQTGVTIAASLVLIPRMVSLLMDGLTVISEAAH
FT                   EFMEKRFPGRELFIGLDSAVGIGHPFVLSLGLLMIPITLILAFILPGNKVLPLADLTAL
FT                   PFYMIFAIVPSKGNLFRGIFTGIVIVIITLYLSGAAAPLMTELAGQIGYNIPKDAVEVT
FT                   SLAVGTQWYTWIVYYGLHWFGGIL"
     atggatatta ttctagattt ctttaaatat attatcgggc ttggtgtaac agttatgatg        60
     ccgattatca ttaccattct aggtgtgatt ttccgcaaaa aaattagtgt agcttttaaa       120
     gcggggctaa cagttggtgt tgggtttgtt ggactaggcg ttatcacttc actcatgtta       180
     acgactatta caccagttac aaaagcactt gtagaaaatt ataattttaa attaaccgca       240
     acggatatcg gttggggagt tgggtcatca ctcgcatggg gaacagaagt cgtaccattt       300
     gttttcgtcg caattattgc aaccaatatt ttaatgattg cctttaaatg gacgaaaaca       360
     atggacgtag atatttggaa ttactggcaa ccacttttca tcgccagtgc actttactta       420
     acaacaggaa gcatgattat tgcgattctt agttcgatta tcaatatggc aattatcttc       480
     aaaattgctg actggacaca aaaagatgtg gagaatgtat taggattaga ggggatttct       540
     ttaccacaaa ttcaaactac cgggtgggcg cttgttggtt atccaatgaa ctggctactc       600
     ggaaaaattc ccggcgttag aaaaattaat tggtccacag agaaagtgca atcacgttta       660
     ggtattttcg gcgaaccgat gcttatgggc ttaattattg gtggtggact tgctgccatt       720
     gctcaaatgc cgctgagcca agtactgcaa actggagtaa cgattgccgc tagtttagta       780
     cttattccgc ggatggtttc ccttctaatg gacggtctta cggttatctc ggaagctgct       840
     catgaattca tggaaaaacg tttcccaggt cgcgaactat ttatcggact agattcagcg       900
     gtggggattg gtcatccatt tgtgctttcg cttggcttac tcatgattcc gattactttg       960
     attttagcgt tcattttgcc aggaaataaa gtattacctt tagctgattt aacggcgctt      1020
     ccattctaca tgatttttgc tattgttcca tccaaaggga atttatttag agggattttc      1080
     acaggtattg ttatcgtcat tatcaccctc tacctatcag gagcagcggc acctttaatg      1140
     acagaacttg caggtcaaat tggttataat ataccgaaag acgctgtaga agtaacctct      1200
     ctagcagttg ggactcagtg gtatacgtgg attgtatatt acggccttca ttggttcgga      1260
     ggtattctat aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page