(data stored in ACNUC10821 zone)

EMBL: AE017262.PE532

AE017262.PE532       Location/Qualifiers
FT   CDS_pept        553674..554354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0540"
FT                   /product="glutamine amidotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00117"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03322"
FT                   /protein_id="AAT03322.1"
FT                   /translation="MIIDVLQHVPHEGPGLIANWARENQHQLKIHSLFEENAHVPNDSD
FT                   FLIVLGGPMGINDTAEFPWLKDERKLIKRLSEQHKPVFGVCLGAQQIAATFGSEITVNK
FT                   EKEVGWFPVKRTSDKLSFFPESLNVFHWHQDTFALPAGATRLFASEGCLNQAFLYGENI
FT                   IGLQFHFEMEKAGIETILRIDEAFITSGKYVQSVEVMREKDVPEDNKQMLEAILDYLIN
FT                   PKTI"
     ttgattattg atgtattgca acatgtgccg cacgaaggac ctggacttat agcgaattgg        60
     gcgagagaaa accagcatca gttaaaaata cattctctat ttgaagaaaa tgctcatgtt       120
     ccaaatgact cggatttttt aattgtactt ggaggaccca tgggaataaa tgatacagcc       180
     gaatttccgt ggttaaaaga cgaacgtaag ctaataaagc gattaagtga acagcataaa       240
     cctgtttttg gtgtctgcct cggcgcacaa caaatcgcag caacattcgg aagcgaaatc       300
     actgtaaata aagaaaaaga agtaggctgg tttcctgtca aaagaacttc cgacaaatta       360
     tcatttttcc cagaatcatt aaatgtgttt cactggcatc aagatacgtt tgcgttacca       420
     gctggcgcca cgcgtttatt tgctagtgag ggttgtttga accaagcttt tttgtacggt       480
     gaaaatatta tcggtttaca gtttcatttt gaaatggaaa aagcggggat tgagacgatt       540
     ttgcgaattg atgaggcgtt tatcacatct ggaaaatatg ttcaaagcgt ggaagtgatg       600
     cgagagaagg atgttccaga agataataaa caaatgcttg aggctatttt agattattta       660
     ataaatccaa aaaccatctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page