(data stored in ACNUC10821 zone)

EMBL: AE017262.PE533

AE017262.PE533       Location/Qualifiers
FT   CDS_pept        complement(554379..554738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0508; match
FT                   to protein family HMM TIGR02058"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03323"
FT                   /protein_id="AAT03323.1"
FT                   /translation="MEQILFIQTGFGVDVHGQNITKAAERAVRNAIFTNSMPGIQGLLP
FT                   DGDLQNMVVNIKLALPCDEEKLDEDTIRAIIPYGTVTIEKMAGGMMTTSGIFLEDKEDK
FT                   NDLMYIVNASVETGY"
     atggaacaaa ttctatttat ccaaactggc tttggcgttg atgttcacgg ccaaaatatt        60
     acaaaagcag ccgaacgagc tgtaagaaat gcgattttta cgaactctat gcccggtatt       120
     caaggacttc ttccagatgg cgacttacaa aatatggttg ttaatatcaa attggcgcta       180
     ccgtgtgatg aagaaaaact tgacgaagat accattcgcg cgattatccc ttatggcact       240
     gtaactattg agaaaatggc tggcggaatg atgactacaa gcggcatttt cttagaagac       300
     aaagaagaca aaaacgattt aatgtatatc gtcaacgctt ctgttgaaac tggatactaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page