(data stored in ACNUC10821 zone)

EMBL: AE017262.PE535

AE017262.PE535       Location/Qualifiers
FT   CDS_pept        555585..557414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0543"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03325"
FT                   /protein_id="AAT03325.1"
FT                   /translation="MKKALKLFLATICMFIMIYPSTAAHAEETNIVNIPDANLKTYLNG
FT                   LLKQASDAPITKTQMNTIQTVTLSGSTYTDLTGLEEAGNLVTLSLNNTNIQTLEPIKNQ
FT                   TSLTYLTVGGDNVKDSLFVDLNGLVNLQSLSISGSEVTHNVFKTFNKLPKLTYLYAQNS
FT                   MKITDISALASLPALTTLFLQFDGIDDFRPLNDFESFKNGNLKALAAFGQNTGRTNPRI
FT                   TLKSGKLDYNETNQTLYLPFSMMPKPLTSFDGTVAPFSKSTSASNTYLGFNDVALPSAR
FT                   LSITDDGITVSGVTKEEFDNLDEIEYNARYDFPTGSYPTPPSMNSYTISSGTYDQYFDI
FT                   SHTLDLTADESFDYNQYDATSEEQFLKDVHAETDDGTAVKSDFDQVVKLDVPGEYTVTL
FT                   NAENAAGLKATPVTVKVTVHEKPVITADSQISYKKESTKSVDEFLQEIHSSVTGNAVLT
FT                   SDFDKVVDLNTPGEYTVTLNAINDRGQKADPVTVVVTVTTSDGEHVNPVPPTPEVKPTP
FT                   QEETDPTIIPEPQSENSEDQVKENNAKTEEKANKTSLTTKENKVEKADKAEKTNQPKTK
FT                   ALPQTGDTNKSTLPIAGVMLSLAALLIFRKSKS"
     atgaaaaaag cactgaaact atttcttgcg acgatttgta tgttcataat gatatatcct        60
     tccacagcag ctcacgcaga agaaacgaat attgttaata ttcctgatgc aaatcttaaa       120
     acctatctta atggtctgct caagcaagca agtgatgcac caattactaa aacacaaatg       180
     aacactatcc aaactgttac actttctggc agcacttata cagacttgac gggtttggag       240
     gaagctggaa atctggtaac actatctctt aacaatacta acatccaaac acttgaaccg       300
     attaaaaacc aaacttcttt gacttactta acagtgggcg gagacaatgt aaaagatagt       360
     cttttcgtag atttaaatgg acttgttaat ttacaaagtc ttagtatcag cggaagcgaa       420
     gtgacacata atgtctttaa gactttcaat aagttgccaa agttaactta tctttatgcg       480
     caaaactcca tgaaaatcac agatatttct gcgcttgctt ccttaccagc cttaacgaca       540
     ctattcttac aatttgatgg cattgatgat tttagacctt taaatgactt tgaaagtttt       600
     aaaaatggca acttgaaagc tcttgctgct tttgggcaaa atacagggcg cacgaatcca       660
     agaattacac ttaaatctgg taagttagat tataatgaaa caaaccaaac gttatattta       720
     ccattttcga tgatgccaaa acctttaacg agttttgatg gcactgttgc accattttct       780
     aaatcgactt ccgcaagtaa tacttattta ggatttaatg atgtggcact cccaagcgca       840
     cgtctatcca ttaccgatga tggtattaca gtcagcggtg taacaaaaga agaattcgac       900
     aatcttgatg aaattgaata taatgcacgc tatgattttc cgactggaag ttacccgaca       960
     ccaccaagca tgaattctta taccatttcc agcgggacat atgatcaata ttttgatatt      1020
     agccacacgc tagatttaac ggcggatgaa agttttgact ataatcaata cgatgcaaca      1080
     tcagaagaac aatttttaaa agatgtacat gctgaaacag atgatggcac agcagtaaag      1140
     agcgattttg atcaagtagt taagcttgat gtaccgggtg aatataccgt gacattaaat      1200
     gcggaaaacg ctgcaggact aaaagcaact cccgtaacag ttaaagtaac cgttcatgaa      1260
     aaaccagtta ttacagccga ttcccaaatt tcttataaaa aagaatcaac taaatcagtc      1320
     gacgaatttt tgcaagaaat ccatagttcg gtaactggaa atgcagtttt aactagtgat      1380
     tttgataaag tagtagattt aaacacccca ggcgaataca ccgtaacttt aaatgcaata      1440
     aatgatcgcg gccaaaaagc agaccctgta accgtagttg tgacagtgac tactagcgac      1500
     ggcgaacatg ttaatccggt tccaccaaca ccagaagtaa aacccacacc tcaagaagaa      1560
     accgacccaa caatcatccc agaacctcaa agcgaaaatt cagaagacca agtgaaagaa      1620
     aataatgcaa aaacagaaga aaaagcaaat aaaacttctt taacaacgaa agaaaacaaa      1680
     gtagaaaaag cagataaagc agaaaaaaca aatcaaccga aaacaaaagc tttgccacaa      1740
     actggtgata ctaataagag caccttacca atcgcaggag taatgctgag tttagcggca      1800
     ctgctgattt tcagaaaaag caaatcttaa                                       1830
//

If you have problems or comments...

PBIL Back to PBIL home page