(data stored in ACNUC10821 zone)

EMBL: AE017262.PE536

AE017262.PE536       Location/Qualifiers
FT   CDS_pept        557515..557946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0544"
FT                   /product="universal stress protein family"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03326"
FT                   /protein_id="AAT03326.1"
FT                   /translation="MEKYHRILVAVDGSEPAKLAFEKGLELALKLDGVLGIASIVDLRA
FT                   FSPNVSYDGSLEEKAELELKTSVNEYAEKARTAGVKQVETFVAKGNPKILLSTDIPAEF
FT                   QADLIICGATGMNRVEKLVLGSVSSYIMAHAICDTLIAR"
     atggaaaaat atcatcgcat tcttgtagca gtggatggtt ctgaaccagc aaaattagcc        60
     tttgaaaaag gactggaact agcgctaaaa ttagacggtg tgcttggaat tgctagtatt       120
     gtcgatttac gtgccttttc cccgaatgtt tcttatgatg gcagcttaga agaaaaagcc       180
     gaactagaat taaaaacgag cgttaatgaa tacgcagaaa aagctagaac ggcaggagtg       240
     aaacaagtag aaacttttgt tgctaaaggt aatccgaaaa tcttactttc cacagacatt       300
     ccagcagagt tccaagcaga tttaattatt tgcggagcga ctgggatgaa ccgagtagaa       360
     aagctagttc ttggtagtgt ttcttcttat attatggctc atgcaatttg cgatacttta       420
     atagctagat aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page