(data stored in ACNUC10821 zone)

EMBL: AE017262.PE538

AE017262.PE538       Location/Qualifiers
FT   CDS_pept        complement(559544..560359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0546"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03328"
FT                   /protein_id="AAT03328.1"
FT                   /translation="MKKNIFKLMMALCAVLLIAGCGNSTSADKKETKETKEDGTVTFYV
FT                   VRHGKTMLNTTDRVQGWSDAVLTPAGEEVVKSAGKGLKDVDFSAAYSSDSGRAIQTANL
FT                   ILKESDKSADKEVQTDPRFREFNFGSYEGDLNENMWTDIAKSQGKTLEEWQKAGISPKD
FT                   FADSVAALDKTRVKEGENWPAEDYATIQARLKEGLTDVAKKESKNGDSNVLLVSHGLSI
FT                   GALLDTIEPGYKLPAEGIKNASVTKITYKDGKFTIGDVNDLSYVEKGSK"
     atgaagaaaa atatttttaa attgatgatg gcgttatgcg cagtactatt aattgcaggt        60
     tgcggtaaca gtacatctgc agacaagaaa gagacaaaag aaactaaaga agatggcact       120
     gtgacatttt atgtagtacg tcatggtaaa acaatgctaa acacaactga ccgtgtacaa       180
     ggttggtctg atgcggttct tactcccgct ggtgaagaag tagttaaaag cgctggtaaa       240
     ggcttaaaag acgttgattt ctctgcagct tacagcagcg acagtggtcg tgctatccaa       300
     actgcaaact taattttgaa agaaagcgat aaatccgctg ataaagaagt acaaactgat       360
     ccacgtttcc gtgaattcaa ttttggttct tatgaaggcg atttaaatga aaatatgtgg       420
     actgatattg cgaaaagcca aggtaaaact ttagaagagt ggcaaaaagc tggtatctcg       480
     ccaaaagatt ttgctgatag tgtagcagct cttgataaaa ctcgtgtgaa agaaggcgaa       540
     aactggcctg ctgaagacta tgcaactatc caagctcgtc taaaagaagg tttaacagat       600
     gttgctaaaa aagaaagcaa aaatggcgat agcaatgtat tactagtttc ccacggacta       660
     agcatcggtg cgcttcttga tactatcgaa ccaggataca aactgcctgc agaaggtatc       720
     aaaaatgcaa gtgtaacaaa aatcacttac aaagatggta aattcactat tggtgatgta       780
     aatgacttaa gctatgtgga aaaaggttct aaataa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page