(data stored in ACNUC10821 zone)

EMBL: AE017262.PE54

AE017262.PE54        Location/Qualifiers
FT   CDS_pept        57089..57700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0056"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF03413"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02844"
FT                   /protein_id="AAT02844.1"
FT                   /translation="MYRKLATVGMTVLLVGALSACSFNDDKDTSSNNSSNETTSSKSSN
FT                   NESSSDSLQNKSFDMSYEDAINAFKDKHSDAEISSVELEKSLGKYVYKVDGISNDNEYE
FT                   MKFNAETKEQLSDETDRLDREDAGGVEKENEKLSLDGIKSPKEAMDKAVSEQAGDVTSW
FT                   KIERELDTTYYEVTVKQDNNKYEIKLNAKTLEILQTEQDD"
     atgtatagaa aattagcaac agtagggatg acggtattat tagtaggagc attatcagca        60
     tgtagtttta atgatgataa ggatacatca tcaaataata gcagcaatga aactactagt       120
     agcaaaagca gtaataatga aagttcatca gatagcttgc aaaacaaaag cttcgatatg       180
     agttatgaag acgcgattaa cgcattcaaa gacaaacata gtgatgcaga aatatctagc       240
     gttgaattag agaaaagctt gggaaaatat gtctataaag ttgatgggat ttcaaatgat       300
     aatgaatacg aaatgaaatt caatgctgaa acaaaagaac aactaagtga tgaaacagat       360
     cgacttgacc gagaagatgc aggtggagtt gaaaaagaaa acgaaaaact tagcttagat       420
     ggaattaaat caccaaaaga agccatggat aaggctgttt ctgaacaagc tggtgacgta       480
     acaagttgga aaatagaaag agaattagat acaacttatt atgaagtgac agtaaaacaa       540
     gataataaca aatacgaaat caaactaaat gcaaaaactt tagaaattct tcaaacggaa       600
     caagacgatt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page