(data stored in ACNUC10821 zone)

EMBL: AE017262.PE540

AE017262.PE540       Location/Qualifiers
FT   CDS_pept        561155..562570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0548"
FT                   /product="drug resistance transporter, EmrB/QacA family"
FT                   /note="identified by similarity to SP:O35018; match to
FT                   protein family HMM PF07690; match to protein family HMM
FT                   TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03330"
FT                   /protein_id="AAT03330.1"
FT                   /translation="MQQEATGGQKIRPIPIIASFLMAGFIGLFSETALNMALSDLIQVF
FT                   DISSATVQWLTTGYLLTLGILVPISGLLLQWFTTRGLFFTAVSFSIAGTLIAALSPTFA
FT                   MLMIGRVVQAVGTALLLPLMFNTILLIFPEHKRGSAMGMIGLVIMFAPAVGPTISGLIL
FT                   ENLTWNWIFWISLPFLIIALLFGMKFMQNVSVVTKPKIDILSIILSTLGFGGVVFAFSS
FT                   AGESGWGSATVLVSIIVGGLALGLFVWRQLTMEKPLMDLKVFKYPMFTLGLILVFISFM
FT                   MILSTMILLPLYLQNSLALAAFSAGLVLLPGGVLNGLMSPFTGRLFDAYGPRALVIPGF
FT                   IVAVVALFFLTRIEVGTSALTIIVLHSVLMIGISMVMMPAQTNGLNQLPPKLYPDGTAI
FT                   MNTLQQVSGAIGTAVAITIMSAGQKAYMETAQGVGPEQMVASLTAGIQNAFVFGLIMAC
FT                   IGLLCSLFIRKAK"
     atgcaacaag aagcaacagg tgggcagaaa attcggccga taccgattat tgcctcattt        60
     ttgatggcgg ggttcattgg gctattcagt gaaactgctc ttaacatggc gcttagtgat       120
     ttgattcagg tgtttgatat tagttcagcg acagtgcagt ggcttacgac aggttatttg       180
     ctaacgcttg gaatattagt accgatttcg ggattacttt tacaatggtt tacaacacga       240
     ggtttatttt ttacagcagt gagtttttcg attgctggta cgctgattgc ggcgctttcg       300
     ccaacgtttg caatgttaat gattgggcgt gtagtgcaag cagtaggtac ggcgctatta       360
     ctaccattaa tgtttaacac gattttactt attttcccag agcataaacg tggctcagca       420
     atggggatga tcgggctggt aattatgttt gctccagcag ttggtccgac aatttcagga       480
     ctaattttag aaaacttaac ttggaactgg attttctgga tttccttgcc attccttatt       540
     attgcgttat tattcggaat gaaatttatg caaaatgttt cggttgttac gaagccgaaa       600
     attgatattt tatcgattat tctttcgacg ctaggttttg gtggagttgt atttgccttt       660
     agtagtgcgg gagaaagtgg ttggggaagc gcaacggtat tagtttcaat tatcgttggt       720
     ggacttgcgc ttggactctt tgtttggcgc caactaacaa tggaaaaacc tttgatggac       780
     ttgaaagtat ttaaataccc aatgttcaca ttaggactta ttttagtatt tatcagcttt       840
     atgatgattc tttcgacgat gattttacta ccgctatact tgcaaaatag tttagcgctc       900
     gcagcatttt cagcaggatt agtattactt ccgggtgggg tgctgaatgg tttaatgtca       960
     ccatttactg gccgtttgtt cgatgcatac ggtccacgcg cacttgttat cccagggttt      1020
     atcgtagcgg ttgtggcact atttttctta acgagaatag aagttggaac atctgcatta      1080
     accatcatcg tgcttcattc ggtgttaatg attgggattt caatggtcat gatgccagcg      1140
     caaacaaacg gattaaacca attgccgcca aaattatatc ctgatggtac ggcgattatg      1200
     aacacattgc aacaagtttc cggcgcgatt ggaacggctg ttgcgattac gatcatgtca      1260
     gctggacaaa aagcttatat ggaaacggcg caaggagtag gaccggagca aatggttgct      1320
     tcactgacag caggaattca aaatgccttt gtctttggac tgattatggc ttgtattggt      1380
     cttctgtgct cgttatttat tcgtaaagct aaataa                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page