(data stored in ACNUC10821 zone)

EMBL: AE017262.PE541

AE017262.PE541       Location/Qualifiers
FT   CDS_pept        562702..563706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0516"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03331"
FT                   /protein_id="AAT03331.1"
FT                   /translation="MAIPRDLKELNKKNIKSILRQQGAMTKAEIAEVTGLSVVTVNKLI
FT                   RDLVENEEILEQDNSVATGGRRAVSYEINPNFQQVLVISLQEKWKKITYSFSVYNLLGE
FT                   PEFVEDMSGEDLDITALKRNTKDLVCAFPKISCVVIGVPGIEIGGKLRAMDFPLLLNVQ
FT                   LRETLEAEVNLPVLVETDTNAAILGYKNRPVKEENIVGLYYPERFPPGAGLLMNGEILK
FT                   GQNGLAGEIKHMPLQVDWDNFDFSVDEIKAHIRKMVLLTMSFYDPETIVLYTNFYFGQK
FT                   DFTEELTEELKQVYPYAVLPEIVLSRKFTTDYRIGLLAFGIDYLENNMTDWRI"
     atggcaattc ctcgtgattt aaaagaattg aataagaaaa atatcaagtc gattttacgg        60
     caacaaggtg cgatgacgaa agcggaaatc gccgaagtga ctggtcttag tgtagttaca       120
     gtgaacaagc tgattcgtga tttagtggaa aatgaagaga ttttagaaca agataattcg       180
     gttgcgactg gcggaagaag agctgtttcg tatgaaatta atcctaattt tcagcaggtg       240
     ttggttatta gtttgcaaga aaagtggaag aaaattactt attctttttc ggtctataat       300
     ttgcttggtg agccggagtt tgtggaggat atgtctgggg aggatttgga cattactgcg       360
     ctgaaacgga atacgaaaga tcttgtttgc gcttttccga agatttcttg tgttgtaatc       420
     ggggtgccgg gaattgagat tggaggtaag ttgcgggcga tggactttcc gctactttta       480
     aatgtgcaat tgcgggagac tttggaggcg gaagtgaatt tgccggtgtt ggttgagacg       540
     gatacgaatg cggcaatttt agggtataaa aatcggccgg tgaaagagga gaatatcgtt       600
     ggactttatt atccggagcg ttttccaccg ggtgcagggc ttttgatgaa cggagagatt       660
     ttgaaaggtc agaacggact ggctggggag attaagcata tgccgcttca agtggactgg       720
     gataactttg acttttcggt cgatgaaatt aaagcacaca ttcgtaaaat ggtgctgcta       780
     acgatgagtt tttatgatcc ggaaacgatt gtgctctata cgaattttta ttttgggcag       840
     aaggatttca ccgaggaact gacggaagag ttaaagcaag tttatccata tgcggttttg       900
     ccggagattg tgttgtcgcg taagtttacg acggattatc ggattgggct tttggcgttt       960
     gggattgatt atttggagaa taatatgacg gattggcgga tataa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page