(data stored in ACNUC10821 zone)

EMBL: AE017262.PE542

AE017262.PE542       Location/Qualifiers
FT   CDS_pept        complement(563739..565055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0550"
FT                   /product="glycosyl hydrolase, family 4"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03332"
FT                   /protein_id="AAT03332.1"
FT                   /translation="MTKGIKIATIGGGSSYTPELIEGFIKRQDELPVRELWLVDVEAGR
FT                   EKLEIVGNLAKRMVEKAGVDMEVHLTLDREEALKDADFVTTQLRVGLLDARVKDERIPN
FT                   SYGVVGQETNGPGGMFKGLRTIPVILDICKDMERLCPDAWLINFANPAGMVTEAVLRYS
FT                   NQKKVVGLCNGPIGIERNIAETLGVDVSEIYVEFVGLNHMVFAKTVYHNGKDVTKDVVF
FT                   KMTEDEAGSSLKNINATGWDKTFLRTLNMIPIDYLRYYWQTKQQLEDQARAYAEHGTRA
FT                   EVVKKVEAELFELYKQEELAEKPKQLEQRGGAYYSEAACNLINSIYNDKRDIQIVNTRN
FT                   NGAILDIDPDSAVETNCVITRQGPIPLASGRLPIAINGIIQEIKTFERLTAEAAVTGDY
FT                   DKALLAMTINPLTPSESVAREMLDELLEAHKEYLPNFFK"
     atgactaaag gtattaaaat cgcaactatt ggtggcggat caagttatac acctgaacta        60
     atcgaaggat ttattaaacg tcaagacgaa ttaccagttc gtgaactatg gttagtcgac       120
     gtagaagctg gccgtgaaaa attagaaatc gttggtaatt tagcaaaacg tatggtagaa       180
     aaagctggcg ttgacatgga agtacattta acactagacc gtgaagaagc tttaaaagat       240
     gctgatttcg taacaacaca attacgtgta ggtttactag atgcacgtgt gaaagatgag       300
     cgcatcccga attcatatgg cgttgttggt caagaaacaa acggaccagg cggcatgttc       360
     aaaggacttc gcacaatccc agttatttta gatatttgta aagacatgga acgcctttgc       420
     ccagatgctt ggttaatcaa ctttgctaac cctgcaggaa tggtaacaga agcagttctt       480
     cgttacagta accaaaagaa agttgtcggc ttatgtaacg gccctatcgg catcgaacgc       540
     aatatcgctg aaactcttgg cgtagacgtt tctgaaattt acgtagaatt cgttggtcta       600
     aaccacatgg tattcgcgaa aactgtttat cataatggca aagacgtaac aaaagatgtt       660
     gttttcaaaa tgacagaaga tgaagctggc tcaagcctta aaaacatcaa cgcaactggt       720
     tgggacaaaa cgttcttgcg tacactaaac atgattccaa tcgactactt gcgctactac       780
     tggcaaacaa aacaacaact ggaagaccaa gctcgcgcat acgcagaaca tggtactcgt       840
     gcagaagttg ttaaaaaagt agaagctgaa ctattcgagc tttacaaaca agaagaactt       900
     gctgaaaaac caaaacaatt agaacaacgc ggcggcgctt actacagtga agcagcatgt       960
     aacctaatta actctatcta caacgacaaa cgcgacattc aaatcgttaa tactcgtaac      1020
     aatggtgcca tccttgatat cgaccctgat tccgcagtag aaacaaactg tgtcatcact      1080
     cgccaaggcc caattccact agcaagcgga cgccttccaa tcgctatcaa cggcatcatc      1140
     caagaaatca aaactttcga gcgcctaaca gccgaagcag cagttactgg agattacgac      1200
     aaagcactcc ttgcaatgac aatcaaccca ctaactccaa gcgaatctgt agcccgcgaa      1260
     atgctggacg aacttttaga agcacataaa gagtatttac cgaatttctt taaataa         1317
//

If you have problems or comments...

PBIL Back to PBIL home page