(data stored in ACNUC10821 zone)

EMBL: AE017262.PE543

AE017262.PE543       Location/Qualifiers
FT   CDS_pept        565257..566009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0551"
FT                   /product="phosphosugar-binding transcriptional regulator,
FT                   RpiR family"
FT                   /note="identified by match to protein family HMM PF01380;
FT                   match to protein family HMM PF01418"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03333"
FT                   /protein_id="AAT03333.1"
FT                   /translation="MLFLDKNLELNDTELDIYNYIVANLDKVVYMRIRDLATEAHVSTT
FT                   TILRFCRKFGCNGFSEFRVKLQLYLEEQKLAQIDMADETTYIDFLKRTAQPEFKAQIQN
FT                   AVEILRDRELVLFAGVGSSGVIAEYGAIYFSSLFTLALHIEDPLNHPFYHLSSKLSDKI
FT                   CMIAISVEGENEDIIRYIHQLKAQNCKVISITNSAKSTIARLSDANIAYYINKEMYQEA
FT                   NITSQLPALYTIENIAREIRTQIDKEKM"
     atgctttttt tggataaaaa tttggaatta aatgatacgg aattagatat ttataattat        60
     attgtggcga atttagataa agttgtttat atgcggattc gcgatttggc gacggaagcg       120
     catgtgagta cgacgacaat tctacgtttt tgccgaaaat ttggttgtaa tggtttttcg       180
     gagtttcggg tgaaattaca gctttatttg gaagagcaga agttggcgca aatcgatatg       240
     gcggatgaaa cgacttatat tgattttctg aaacggacgg cgcaacctga gtttaaagcg       300
     caaattcaaa acgcggtcga gattcttcgt gatcgcgaac tggttttatt tgctggggtg       360
     ggttcatcgg gtgtaattgc tgaatatggc gcgatttatt tttcgtcatt atttacgctg       420
     gcgctacata ttgaagatcc gcttaaccac ccgttttacc atttatcgag caaattatcc       480
     gataaaatct gcatgattgc gatttcggtg gaaggggaaa atgaagacat cattcgctac       540
     attcaccaac tgaaggcgca aaattgtaaa gtaatttcga ttacgaatag cgcgaaatca       600
     acaattgcaa ggctatctga cgcgaacatc gcttattata ttaataagga aatgtaccag       660
     gaagcgaata tcacgtccca actaccggcg ctatatacaa ttgaaaatat tgcccgggaa       720
     ataagaacgc aaattgataa agagaaaatg taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page