(data stored in ACNUC10821 zone)

EMBL: AE017262.PE544

AE017262.PE544       Location/Qualifiers
FT   CDS_pept        566116..566559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0524"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03334"
FT                   /protein_id="AAT03334.1"
FT                   /translation="MYSNRKEKVVFTLIMCSLMILCMSSYNIFLENGIGTDSLLIVLKA
FT                   FVPFLFIGFLLDFFVVGKIVYRLHALLVSEDASKFKKIIMMQLLMVTFMCVLMSTLSLI
FT                   VNQGEWSHLGILILRNYFVALFLQIFIVSPFVRLISPRIFALL"
     atgtacagta ataggaaaga gaaggtcgtt tttacactta ttatgtgttc tttgatgatt        60
     ttatgcatga gctcttataa tatctttctt gaaaatggta ttggtacaga ttctttattg       120
     attgttttaa aagcatttgt cccgtttctt tttattggat ttttattaga cttttttgtt       180
     gtcggaaaaa ttgtgtatcg tctgcacgcc cttttggtta gtgaagatgc ttcgaaattt       240
     aaaaagatca ttatgatgca attgttgatg gttacattta tgtgtgtgct tatgtcgacg       300
     cttagcctga ttgtgaacca aggcgaatgg agtcatctag gtattcttat tttgcgcaat       360
     tattttgtgg ctttattttt gcaaattttt atcgtgtcac cgtttgtgcg gctaattagt       420
     ccgcggattt ttgcgctttt gtaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page