(data stored in ACNUC10821 zone)

EMBL: AE017262.PE546

AE017262.PE546       Location/Qualifiers
FT   CDS_pept        complement(568321..568422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03336"
FT                   /protein_id="AAT03336.1"
FT                   /translation="MPKTNKKSHDFLKRDRGFMIGITKNGVNSIRFH"
     atgccaaaaa caaataaaaa aagccacgat ttcttaaaaa gagatcgtgg ttttatgatt        60
     ggtataacaa agaacggggt aaatagtata agatttcatt aa                          102
//

If you have problems or comments...

PBIL Back to PBIL home page