(data stored in ACNUC10821 zone)

EMBL: AE017262.PE547

AE017262.PE547       Location/Qualifiers
FT   CDS_pept        complement(568406..569146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0555"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by similarity to SP:P32184; match to
FT                   protein family HMM PF00376; match to protein family HMM
FT                   PF07739"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03337"
FT                   /protein_id="AAT03337.1"
FT                   /translation="MQIKELAELTGVSVRTLHHYDKIGLLVPQKDDWNGYRIYSENDID
FT                   KLQQILFFKELDFPLKKIKQILDDPFFDKNVALDLQRHLLIEKKQRIETMLATLDQTIR
FT                   NEKGEITMTNKEKFTGFDFSTNPYEEEAKKRWGDKVVEKANEKVNNMNEKEKLTLKESF
FT                   DAEFRHLASVRELSPESEEAQLAIDHFFHYLNNTHGNIYSLEAFAGLGEMYVADERFTK
FT                   NIDQFGDGLSHFLKEAMNIYAKNK"
     atgcaaataa aagaattagc tgaactcact ggtgtaagtg tgcgcacact ccaccactac        60
     gataaaatag gcctacttgt cccgcaaaaa gatgactgga atggctatcg tatttattca       120
     gaaaacgata tcgacaaatt acaacaaatt cttttcttta aagaactcga tttccctttg       180
     aaaaaaataa aacaaattct tgatgatcct tttttcgata aaaatgttgc tttagatttg       240
     cagcgtcact tactaataga aaaaaagcag cgcattgaaa ccatgctagc aaccctcgac       300
     cagaccatca ggaatgaaaa aggagaaata acaatgacaa acaaagaaaa attcactggt       360
     tttgattttt ccaccaatcc atacgaagaa gaagcaaaaa aacgttgggg cgataaagta       420
     gtagaaaaag ccaatgaaaa agtaaataat atgaacgaaa aagaaaaatt aactttaaaa       480
     gaaagtttcg acgcagaatt tcgtcattta gcatctgttc gagaactctc tcccgagtca       540
     gaagaagccc aactcgcaat tgaccatttt ttccattact tgaataacac ccacggcaat       600
     atatattccc tagaagcctt tgctggtctt ggggaaatgt acgttgctga tgagcgcttc       660
     actaaaaata tcgatcagtt cggtgatggc ctttctcact tcctcaaaga agccatgaac       720
     atttatgcca aaaacaaata a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page