(data stored in ACNUC10821 zone)

EMBL: AE017262.PE55

AE017262.PE55        Location/Qualifiers
FT   CDS_pept        57957..58571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0057"
FT                   /product="putative accessory gene regulator protein B"
FT                   /note="identified by similarity to GP:16412462; match to
FT                   protein family HMM PF04647"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02845"
FT                   /db_xref="GOA:Q725B6"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q725B6"
FT                   /protein_id="AAT02845.1"
FT                   /translation="MSNFTAKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINV
FT                   MKFALVYGIALVTGLLLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLMMFVLAPFVF
FT                   QNIPSNNWIVLGTFGFILLNMFLFAPADTESLPLIGEEHRKTLKRKAMIGTLILTGIAL
FT                   LIPFAEMKTLIMVGSLFQVISINPLTYKLLKRRYRNYEKYE"
     ttgagtaatt ttactgcaaa agtccctttg tcagaaagaa tggcggatgt gctgatttcg        60
     aaagaccgct ggaaagatga tgaagaaggt tatttaaaag taaaatatgg actggaaata       120
     attctaatta atgtcatgaa gtttgctctc gtatacggta ttgccttagt aacagggtta       180
     ttactgcaaa cagtgacagt acatctgtca tatttatggc tcagacggta ttcttttgga       240
     ttacatgcaa ccaaaacatt gaattgcacg ttaattagct tgatgatgtt tgtgcttgcg       300
     ccatttgttt ttcaaaatat cccctctaat aattggattg ttttaggtac atttggattt       360
     atactgctca acatgtttct attcgctccg gcagacacag aaagtttgcc tttaatcggt       420
     gaagaacacc ggaaaacact aaaaagaaaa gcgatgatag ggacgctaat tttaacggga       480
     attgcgttgc taataccatt cgcagagatg aaaacattaa tcatggtagg atctttgttt       540
     caggtgataa gtattaatcc acttacttac aaactattga aaaggaggta tcggaactat       600
     gaaaaatatg aataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page