(data stored in ACNUC10821 zone)

EMBL: AE017262.PE550

AE017262.PE550       Location/Qualifiers
FT   CDS_pept        572351..573601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0558"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03340"
FT                   /protein_id="AAT03340.1"
FT                   /translation="MVIADYLALFAVVCIWGLLLINIVLIVAGYVYYLKNEARKVPEIP
FT                   AEVPFVSVMVPAHNEGKVIVKTVESLLAFDYPVDRYEIIVINDNSSDNSAELLAAIQAK
FT                   NPTRFLKIINTDNITGGKGKSNALNIGFAESRGELVAIYDADNTPERQALRILVGEITN
FT                   DAKLGAVIGKFRTRNRNASWLTRFINIETLSFQWMAQAGRWALFKLCTIPGTNFIVRRS
FT                   LLEEIGGWDVKAVAEDTEISFRIYMMGYRIKFQAKAVTWEQEPQTLPVWFKQRSRWAKG
FT                   NIYVILKNVPLLFKREGRRVRFDILYFLSIYFLLLTSLIVSDVLLVLYALGLVHTTLAG
FT                   LSGALWLLAILLFVAGTFITLTTEKGEISFSNLLFIMLMYVTYCQLWMVVAAYGFFIFL
FT                   KDTILKRETKWYKTERF"
     atggttattg cagattattt agcattattc gcggtggtgt gtatttgggg acttttgcta        60
     attaatattg tgttaattgt tgcaggatat gtttattatt tgaaaaatga agcgcgaaaa       120
     gtgcccgaaa taccagcgga agtaccattt gtttctgtca tggtgccggc ccataatgaa       180
     ggaaaagtaa tcgtgaaaac agttgaatca ctgcttgctt ttgattatcc ggtcgatcgt       240
     tacgaaatta ttgtcattaa cgataattct tcagataata gcgcggaact tttagccgcc       300
     attcaagcaa aaaatccgac acgcttttta aaaattatta ataccgataa tattacaggc       360
     ggaaaaggaa aatcgaatgc gctcaatatt gggtttgcgg aaagtcgtgg ggaactggtg       420
     gcgatttatg atgctgataa tacaccggaa cggcaagcgc taagaatcct tgttggtgag       480
     attacaaatg atgcgaaact tggtgcagtc atcggtaaat tcagaacccg aaatcgaaat       540
     gcaagctggt taacgcgatt tatcaatatt gaaacgctta gttttcagtg gatggctcag       600
     gccggcagat gggccctttt caaactatgc accattcctg gtactaattt tattgtaaga       660
     aggtcgctcc tagaagaaat cggtggctgg gatgtgaaag ctgtcgcgga agataccgag       720
     attagctttc ggatttacat gatgggttac cgaatcaaat tccaagcgaa ggctgttacg       780
     tgggaacaag agccgcaaac attaccagtt tggttcaaac agcgctcaag atgggcgaaa       840
     ggcaatattt atgtaatttt aaaaaacgtt ccactccttt tcaaacgaga aggtaggcgc       900
     gttcgctttg atattttata ctttttatcg atttactttt tattattaac ttccttgatt       960
     gttagtgatg ttttactcgt attatatgcg ctgggacttg tacatacaac gcttgctggc      1020
     cttagcgggg cactttggtt gctagccatt ttactttttg tcgcaggtac ttttattaca      1080
     ctcaccacgg aaaaaggcga aatcagtttt tcaaatttgt tatttattat gttgatgtat      1140
     gtgacgtatt gccagctttg gatggtggtc gccgcatatg gattctttat tttcttaaaa      1200
     gataccatac taaaaaggga aaccaaatgg tataaaaccg agcgtttcta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page